PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Traes_3AL_EF72B5A0D.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 99aa MW: 10908.2 Da PI: 6.7899 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 80.3 | 2.5e-25 | 1 | 47 | 51 | 97 |
NF-YB 51 sdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 sdkcq+ekrktingddllwa+atlGfe+yv+plk+yl+kyr++eg++ Traes_3AL_EF72B5A0D.1 1 SDKCQKEKRKTINGDDLLWAMATLGFEEYVDPLKIYLQKYRDMEGDS 47 89*******************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 3.6E-21 | 1 | 57 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 3.59E-16 | 2 | 54 | IPR009072 | Histone-fold |
PRINTS | PR00615 | 5.7E-12 | 4 | 22 | No hit | No description |
PRINTS | PR00615 | 5.7E-12 | 23 | 41 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 99 aa Download sequence Send to blast |
SDKCQKEKRK TINGDDLLWA MATLGFEEYV DPLKIYLQKY RDMEGDSKLT SKSGEGSVKK 60 DIIGAHSGAT SSNAQAMVQH GGYAQGMGYM QPQYHNGDT |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1n1j_A | 2e-17 | 1 | 42 | 52 | 93 | NF-YB |
4awl_B | 2e-17 | 1 | 42 | 53 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
4csr_A | 2e-17 | 1 | 42 | 53 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | GU902788 | 1e-167 | GU902788.1 Triticum monococcum nuclear transcription factor Y subunit B4 mRNA, partial cds. | |||
GenBank | KJ862215 | 1e-167 | KJ862215.1 Triticum aestivum eukaryotic transcription factor NF-Y subunit B4 mRNA, complete cds. | |||
GenBank | KM078741 | 1e-167 | KM078741.1 Triticum aestivum CCAAT-binding transcription factor A (NFYB-D4) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020182576.1 | 3e-68 | nuclear transcription factor Y subunit B-2-like | ||||
Refseq | XP_020182577.1 | 3e-68 | nuclear transcription factor Y subunit B-2-like | ||||
Swissprot | P25209 | 5e-53 | NFYB_MAIZE; Nuclear transcription factor Y subunit B | ||||
TrEMBL | G0TEQ6 | 4e-68 | G0TEQ6_TRIMO; Nuclear transcription factor Y subunit B4 (Fragment) | ||||
STRING | Traes_3AL_EF72B5A0D.1 | 2e-68 | (Triticum aestivum) | ||||
STRING | Traes_3B_924B78EE5.1 | 2e-68 | (Triticum aestivum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP201 | 38 | 331 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G53340.1 | 5e-33 | nuclear factor Y, subunit B10 |
Publications ? help Back to Top | |||
---|---|---|---|
|