PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Traes_2BL_94E5996F7.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 134aa MW: 14717.4 Da PI: 10.6027 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 45.5 | 1.7e-14 | 60 | 116 | 6 | 62 |
HHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 6 rerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 + +r++kNRe+A rsR+RK+a+++eLe++v L + N +Lk + + l+ e+a+l+++ Traes_2BL_94E5996F7.1 60 KSIRAMKNRESALRSRARKRAYTQELEKEVRRLVEDNLKLKRQCKLLQSEIAALTAQ 116 679*************************************************99876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 1.4E-11 | 54 | 119 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 10.507 | 57 | 113 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF00170 | 1.6E-11 | 60 | 115 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 6.88E-12 | 60 | 115 | No hit | No description |
Gene3D | G3DSA:1.20.5.170 | 9.1E-14 | 62 | 116 | No hit | No description |
CDD | cd14707 | 8.62E-18 | 63 | 113 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 134 aa Download sequence Send to blast |
MSWEEPGSPQ LSLSGFSSLP SISSTAHPPA RLPSLSLSIG NGSADGEDQQ LGVSSDDGHK 60 SIRAMKNRES ALRSRARKRA YTQELEKEVR RLVEDNLKLK RQCKLLQSEI AALTAQQASN 120 KQSSPHRRTS STQF |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | EU307116 | 0.0 | EU307116.1 Triticum aestivum FD-like 15 protein mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020174160.1 | 8e-84 | bZIP transcription factor 27-like | ||||
TrEMBL | B4Y1F0 | 2e-91 | B4Y1F0_WHEAT; FD-like 15 protein | ||||
STRING | Traes_2BL_94E5996F7.1 | 4e-92 | (Triticum aestivum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP4017 | 30 | 72 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G35900.1 | 3e-11 | bZIP family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|