PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Traes_2BL_3237AA694.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 249aa MW: 26195.9 Da PI: 6.7991 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 178.8 | 4.9e-56 | 33 | 128 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkk 89 +eqdrflPianvsrimk+ lPanakisk+aketvqecvsefisfvt+easdkcqrekrktingddllwa++tlGfe yv+plk+yl++ Traes_2BL_3237AA694.1 33 KEQDRFLPIANVSRIMKRSLPANAKISKEAKETVQECVSEFISFVTGEASDKCQREKRKTINGDDLLWAMTTLGFEVYVAPLKAYLNR 120 89************************************************************************************** PP NF-YB 90 yrelegek 97 yre+egek Traes_2BL_3237AA694.1 121 YREVEGEK 128 ******97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 2.1E-51 | 29 | 138 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 3.26E-38 | 35 | 141 | IPR009072 | Histone-fold |
Pfam | PF00808 | 6.2E-27 | 38 | 102 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 5.8E-18 | 66 | 84 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 69 | 85 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 5.8E-18 | 85 | 103 | No hit | No description |
PRINTS | PR00615 | 5.8E-18 | 104 | 122 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 249 aa Download sequence Send to blast |
MKSRKSYGQQ QSHLLSPVGS PSSDNGGGDS PAKEQDRFLP IANVSRIMKR SLPANAKISK 60 EAKETVQECV SEFISFVTGE ASDKCQREKR KTINGDDLLW AMTTLGFEVY VAPLKAYLNR 120 YREVEGEKAA VVGGSRHGDD DAHSSLSAAG DALAPQYPHG AGDRGVQDGD VGGHDAHVGL 180 MMGVNMGFSP GTGTTFYAAP GAAHGRRAYG GGEGARGIDF EGAFGGDRGK NGVGGEREFA 240 GHLHGAVQW |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 5e-46 | 33 | 123 | 2 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 5e-46 | 33 | 123 | 2 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in the regulation of flowering time under long day (LD) conditions. Functions as repressor of flowering, independently of HD1 and GHD7. Controls flowering time by negatively regulating the expression of EHD1 and HD3A (PubMed:20566706, PubMed:21148627). Regulates plant height by promoting cell elongation in the internodes (PubMed:20566706). Component of the NF-Y/HAP transcription factor complex (By similarity). {ECO:0000250, ECO:0000269|PubMed:20566706, ECO:0000269|PubMed:21148627}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Circadian-regulation under long day (LD) conditions. Expression increases in the middle of daytime, peaks around the end of the light period and gradually decreases during the dark period and beginning of daylight. {ECO:0000269|PubMed:26542958}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AB124648 | 1e-121 | AB124648.1 Oryza sativa Indica Group Hd5 gene for Heading date 5, complete cds, cultivar:Kasalath. | |||
GenBank | AB124649 | 1e-121 | AB124649.1 Oryza sativa Indica Group Hd5 mRNA for Heading date 5, complete cds, cultivar:Kasalath. | |||
GenBank | AY062182 | 1e-121 | AY062182.1 Oryza sativa (indica cultivar-group) HAP3-like transcriptional-activator (HAP3b) mRNA, complete cds. | |||
GenBank | CP012616 | 1e-121 | CP012616.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 8 sequence. | |||
GenBank | CT837794 | 1e-121 | CT837794.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCRA121O04, full insert sequence. | |||
GenBank | KR815350 | 1e-121 | KR815350.1 Oryza sativa days to heading 8 (DTH8) gene, partial cds. | |||
GenBank | KR815351 | 1e-121 | KR815351.1 Oryza sativa days to heading 8 (DTH8) gene, partial cds. | |||
GenBank | LC016712 | 1e-121 | LC016712.1 Oryza sativa Indica Group Hd5 gene for heading date 5, complete cds, cultivar: Qiu Zhao Zong. | |||
GenBank | LC016713 | 1e-121 | LC016713.1 Oryza sativa Indica Group Hd5 gene for heading date 5, complete cds, cultivar: Tupa 121-3. | |||
GenBank | LC016714 | 1e-121 | LC016714.1 Oryza sativa Indica Group Hd5 gene for heading date 5, complete cds, cultivar: Muha. | |||
GenBank | LC016716 | 1e-121 | LC016716.1 Oryza sativa Indica Group Hd5 gene for heading date 5, complete cds, cultivar: Deng Pao Zhai. | |||
GenBank | LC016718 | 1e-121 | LC016718.1 Oryza sativa Indica Group Hd5 gene for heading date 5, complete cds, cultivar: Naba. | |||
GenBank | LC016719 | 1e-121 | LC016719.1 Oryza sativa Indica Group Hd5 gene for heading date 5, complete cds, cultivar: Bei Khe. | |||
GenBank | LC016721 | 1e-121 | LC016721.1 Oryza sativa Indica Group Hd5 gene for heading date 5, complete cds, cultivar: Bleiyo. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020195900.1 | 1e-179 | nuclear transcription factor Y subunit B-3-like | ||||
Swissprot | Q0J7P4 | 1e-72 | HD5_ORYSJ; Nuclear transcription factor Y subunit B-11 | ||||
TrEMBL | A0A3B6CBS9 | 0.0 | A0A3B6CBS9_WHEAT; Uncharacterized protein | ||||
TrEMBL | A0A446MHK5 | 0.0 | A0A446MHK5_TRITD; Uncharacterized protein | ||||
STRING | Traes_2BL_3237AA694.1 | 0.0 | (Triticum aestivum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP201 | 38 | 331 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G14540.1 | 9e-63 | nuclear factor Y, subunit B3 |
Publications ? help Back to Top | |||
---|---|---|---|
|