PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Traes_2AS_66F050AC7.1

Organism

Triticum aestivum

Taxonomic ID

4565

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum

Family

HSF

Protein Properties

Length: 106aa MW: 11577.9 Da PI: 4.7652

Description

HSF family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Traes_2AS_66F050AC7.1	genome	IWGSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	HSF_DNA-bind	80.5	2.6e-25	43	101	2	60
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHT CS HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmY 60 Fl+k+y++++d+++++++sws+ +nsfvv+d++ fa+ +Lp++Fkhsnf+SFvRQLn+Y Traes_2AS_66F050AC7.1 43 FLTKTYDMVDDPNTDSIMSWSAGNNSFVVWDPHAFATVLLPRHFKHSNFSSFVRQLNTY 101 9*********************************************************9 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.10	1.8E-27	37	101	IPR011991	Winged helix-turn-helix DNA-binding domain
SMART	SM00415	2.3E-21	39	104	IPR000232	Heat shock factor (HSF)-type, DNA-binding
SuperFamily	SSF46785	5.8E-24	39	101	IPR011991	Winged helix-turn-helix DNA-binding domain
PRINTS	PR00056	1.4E-14	43	66	IPR000232	Heat shock factor (HSF)-type, DNA-binding
Pfam	PF00447	5.8E-21	43	101	IPR000232	Heat shock factor (HSF)-type, DNA-binding
PRINTS	PR00056	1.4E-14	81	93	IPR000232	Heat shock factor (HSF)-type, DNA-binding
PRINTS	PR00056	1.4E-14	94	106	IPR000232	Heat shock factor (HSF)-type, DNA-binding

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 106 aa Download sequence Send to blast
MDPVPGLVKE EEEEGAHGRG DSPAVGAAPR PMEGLHDAGP PPFLTKTYDM VDDPNTDSIM 60 SWSAGNNSFV VWDPHAFATV LLPRHFKHSN FSSFVRQLNT YVSLLA

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5d5u_B	2e-18	38	101	21	87	Heat shock factor protein 1
5d5v_B	2e-18	38	101	21	87	Heat shock factor protein 1
5d5v_D	2e-18	38	101	21	87	Heat shock factor protein 1
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional regulator that specifically binds DNA of heat shock promoter elements (HSE). {ECO:0000250}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By heat stress. {ECO:0000269\|PubMed:18064488}.

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	KF208544	1e-169	KF208544.1 Triticum aestivum heat shock factor A2b (HsfA2b) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020146162.1	9e-66	heat stress transcription factor A-2b-like
Swissprot	Q6VBB2	4e-43	HFA2B_ORYSJ; Heat stress transcription factor A-2b
TrEMBL	A0A446KL05	1e-72	A0A446KL05_TRITD; Uncharacterized protein
STRING	Traes_2AS_66F050AC7.1	2e-73	(Triticum aestivum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP308	37	231

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G26150.1	2e-40	heat shock transcription factor A2

Publications ? help Back to Top
Brenchley R, et al. Analysis of the bread wheat genome using whole-genome shotgun sequencing. Nature, 2012. 491(7426): p. 705-10 [PMID:23192148] Rezaei MK,Shobbar ZS,Shahbazi M,Abedini R,Zare S Glutathione S-transferase (GST) family in barley: identification of members, enzyme activity, and gene expression pattern. J. Plant Physiol., 2013. 170(14): p. 1277-84 [PMID:23664583]