PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Tp6g12940 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 191aa MW: 22631.2 Da PI: 4.6841 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 102.3 | 6.5e-32 | 17 | 138 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk....k 96 lppGfrF+P de+lv eyL+kkv ++++++ ++e++ ++v+PwdL +++ke+y+F+k+++++ rk r t sgyW++ + +ev+++ Tp6g12940 17 LPPGFRFDPDDEDLVFEYLAKKVLHRPMDF--DLPELRSCNVDPWDLL---GEKNKEVYYFVKKEERE----RKGRETLSGYWEECEE-EEVMESgdrsC 106 79*************************999..49*************6...56789*******99875....899*********8866.66777646555 PP NAM 97 gelvglkktLvfykgrapkgektdWvmheyrl 128 ++l g +kt++fy g++p+g+ t W+m e+rl Tp6g12940 107 NHLEGRRKTFAFYIGKKPRGTITPWIMYEFRL 138 666***************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 3.14E-34 | 6 | 163 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 33.802 | 17 | 164 | IPR003441 | NAC domain |
Pfam | PF02365 | 7.2E-19 | 18 | 138 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 191 aa Download sequence Send to blast |
MDISTQRFAM NGRSMRLPPG FRFDPDDEDL VFEYLAKKVL HRPMDFDLPE LRSCNVDPWD 60 LLGEKNKEVY YFVKKEERER KGRETLSGYW EECEEEEVME SGDRSCNHLE GRRKTFAFYI 120 GKKPRGTITP WIMYEFRLLS SRATRWSSSR GEVGKWRAVK VVVKEENEEE IEEDDQHASD 180 ESDGEEVVQS R |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 5e-19 | 15 | 139 | 15 | 143 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 5e-19 | 15 | 139 | 15 | 143 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 5e-19 | 15 | 139 | 15 | 143 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 5e-19 | 15 | 139 | 15 | 143 | NO APICAL MERISTEM PROTEIN |
3swm_A | 6e-19 | 15 | 139 | 18 | 146 | NAC domain-containing protein 19 |
3swm_B | 6e-19 | 15 | 139 | 18 | 146 | NAC domain-containing protein 19 |
3swm_C | 6e-19 | 15 | 139 | 18 | 146 | NAC domain-containing protein 19 |
3swm_D | 6e-19 | 15 | 139 | 18 | 146 | NAC domain-containing protein 19 |
3swp_A | 6e-19 | 15 | 139 | 18 | 146 | NAC domain-containing protein 19 |
3swp_B | 6e-19 | 15 | 139 | 18 | 146 | NAC domain-containing protein 19 |
3swp_C | 6e-19 | 15 | 139 | 18 | 146 | NAC domain-containing protein 19 |
3swp_D | 6e-19 | 15 | 139 | 18 | 146 | NAC domain-containing protein 19 |
4dul_A | 5e-19 | 15 | 139 | 15 | 143 | NAC domain-containing protein 19 |
4dul_B | 5e-19 | 15 | 139 | 15 | 143 | NAC domain-containing protein 19 |
Search in ModeBase |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Tp6g12940 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT015150 | 0.0 | BT015150.1 Arabidopsis thaliana At5g50820 gene, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_199895.3 | 1e-117 | NAC domain containing protein 97 | ||||
TrEMBL | A0A178UQH2 | 1e-115 | A0A178UQH2_ARATH; NAC097 | ||||
TrEMBL | Q9FGQ1 | 1e-115 | Q9FGQ1_ARATH; NAC domain containing protein 97 | ||||
STRING | AT5G50820.1 | 1e-116 | (Arabidopsis thaliana) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM14666 | 18 | 21 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G50820.1 | 1e-101 | NAC domain containing protein 97 |