PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Tp57577_TGAC_v2_mRNA9359 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 198aa MW: 22147.5 Da PI: 9.3479 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 76.4 | 2.1e-24 | 16 | 64 | 1 | 49 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49 k+i+n++n qvtfskRr g++KKA+EL++LC+++va+++fs++gk + + Tp57577_TGAC_v2_mRNA9359 16 KKISNETNLQVTFSKRRSGLFKKASELCTLCGVDVALVVFSPSGKTFSF 64 68******************************************97766 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 1.1E-34 | 8 | 67 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 25.791 | 8 | 68 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.28E-37 | 9 | 76 | No hit | No description |
SuperFamily | SSF55455 | 8.37E-30 | 9 | 85 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.0E-21 | 10 | 30 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 2.9E-26 | 17 | 64 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.0E-21 | 30 | 45 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.0E-21 | 45 | 66 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 198 aa Download sequence Send to blast |
MSSGRRGQGR QKIEMKKISN ETNLQVTFSK RRSGLFKKAS ELCTLCGVDV ALVVFSPSGK 60 TFSFGHPNVD TVIDRYFSQV LPQNNDTMQF IEARRSANVS ALNAHLTQIN NTLDDAKKHG 120 DELSHFLKEI KALLWWACPI SGMNRVELEF LKKALEELKN LVAQHVIGIS IQHAPTQFLI 180 HTLISTSNIF CYCSTHI* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6byy_A | 3e-16 | 9 | 94 | 2 | 91 | MEF2 CHIMERA |
6byy_B | 3e-16 | 9 | 94 | 2 | 91 | MEF2 CHIMERA |
6byy_C | 3e-16 | 9 | 94 | 2 | 91 | MEF2 CHIMERA |
6byy_D | 3e-16 | 9 | 94 | 2 | 91 | MEF2 CHIMERA |
6bz1_A | 4e-16 | 9 | 87 | 2 | 80 | MEF2 CHIMERA |
6bz1_B | 4e-16 | 9 | 87 | 2 | 80 | MEF2 CHIMERA |
6bz1_C | 4e-16 | 9 | 87 | 2 | 80 | MEF2 CHIMERA |
6bz1_D | 4e-16 | 9 | 87 | 2 | 80 | MEF2 CHIMERA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. Required for suppression of cellularization and promotion of nuclear proliferation during early endosperm development. The FERTILIZATION-INDEPENDENT SEED (FIS) polycomb complex is required for suppression of ALG62 expression at the end of the syncytial phase of endosperm development. {ECO:0000269|PubMed:18334668}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Tp57577_TGAC_v2_mRNA9359 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004496799.1 | 4e-93 | agamous-like MADS-box protein AGL62 | ||||
Swissprot | Q9FKK2 | 2e-52 | AGL62_ARATH; Agamous-like MADS-box protein AGL62 | ||||
TrEMBL | A0A2K3M4V8 | 1e-145 | A0A2K3M4V8_TRIPR; Agamous-like mads-box protein agl62-like | ||||
STRING | XP_004496799.1 | 1e-92 | (Cicer arietinum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF128 | 33 | 331 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G60440.1 | 3e-51 | AGAMOUS-like 62 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Tp57577_TGAC_v2_mRNA9359 |
Publications ? help Back to Top | |||
---|---|---|---|
|