PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Tp57577_TGAC_v2_mRNA3298 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 101aa MW: 11946.3 Da PI: 5.3128 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 31.9 | 3.1e-10 | 60 | 91 | 1 | 32 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmg 32 rg W++eEde+l+++++ G g+W+++++ g Tp57577_TGAC_v2_mRNA3298 60 RGLWSPEEDEKLINYITTQGQGCWSSVPKLAG 91 789**************************999 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 6.0E-13 | 52 | 89 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 1.87E-8 | 54 | 94 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 11.703 | 55 | 100 | IPR017930 | Myb domain |
Pfam | PF00249 | 1.3E-7 | 60 | 91 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 2.96E-4 | 63 | 100 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 101 aa Download sequence Send to blast |
MRQIYLWNTR NDEEEEEEMR GDDNDSKEKD NETYIDQTKE KKETRDIMAH SCCHKEKVKR 60 GLWSPEEDEK LINYITTQGQ GCWSSVPKLA GSIKRKFIKF * |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Tp57577_TGAC_v2_mRNA3298 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
TrEMBL | A0A2Z6MMW8 | 1e-27 | A0A2Z6MMW8_TRISU; Uncharacterized protein |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF17500 | 4 | 6 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G13890.1 | 6e-22 | myb domain protein 26 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Tp57577_TGAC_v2_mRNA3298 |