PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Tp57577_TGAC_v2_mRNA32786 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
|
||||||||
Family | NF-YC | ||||||||
Protein Properties | Length: 145aa MW: 16411.9 Da PI: 5.5681 | ||||||||
Description | NF-YC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YC | 135.8 | 1.3e-42 | 1 | 79 | 23 | 101 |
NF-YC 23 larikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivprdel 101 larikki+kadedvkmi aeaPvl++kace+fi eltlrsw+h+eenkrrtl+k++iaaa+++tdi+dflvdivp+d+l Tp57577_TGAC_v2_mRNA32786 1 LARIKKIMKADEDVKMIFAEAPVLFAKACEMFISELTLRSWNHTEENKRRTLQKNNIAAAIAKTDIYDFLVDIVPHDDL 79 79**************************************************************************987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF00808 | 2.2E-18 | 1 | 61 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
Gene3D | G3DSA:1.10.20.10 | 3.3E-34 | 1 | 75 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 8.05E-24 | 2 | 78 | IPR009072 | Histone-fold |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 145 aa Download sequence Send to blast |
LARIKKIMKA DEDVKMIFAE APVLFAKACE MFISELTLRS WNHTEENKRR TLQKNNIAAA 60 IAKTDIYDFL VDIVPHDDLK DEVLASIPRG TMHVGGPADA LPYYYMPPQQ PVVDPNMYAE 120 QPHPFMAPQM WPQPSDQRPP SPDH* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5g49_B | 5e-43 | 1 | 76 | 20 | 95 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT C-3 |
Search in ModeBase |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 48 | 54 | RRTLQKN |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters (By similarity). Interacts with REF6 to directly regulate SOC1 transcription in response to flowering signals from photoperiod and gibberellic acid pathways (PubMed:25105952). {ECO:0000250, ECO:0000269|PubMed:25105952}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Tp57577_TGAC_v2_mRNA32786 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004494629.1 | 2e-85 | nuclear transcription factor Y subunit C-3-like | ||||
Swissprot | Q8L4B2 | 2e-55 | NFYC9_ARATH; Nuclear transcription factor Y subunit C-9 | ||||
TrEMBL | A0A2K3P697 | 2e-97 | A0A2K3P697_TRIPR; Nuclear transcription factor Y subunit C-9-like protein | ||||
STRING | XP_004494629.1 | 9e-85 | (Cicer arietinum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1257 | 34 | 108 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G08970.4 | 2e-53 | nuclear factor Y, subunit C9 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Tp57577_TGAC_v2_mRNA32786 |