PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Tp57577_TGAC_v2_mRNA2786 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 194aa MW: 21621.2 Da PI: 7.086 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 27 | 9.6e-09 | 83 | 127 | 6 | 50 |
HHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 6 rerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50 r +r NReA +++R++Kka+++ Lee+vk+L+ N++L +l+ Tp57577_TGAC_v2_mRNA2786 83 RPKRTSGNREAVKKYREKKKAQTAYLEEEVKKLKMLNQQLLRKLQ 127 6688899*********************************99987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.20.5.170 | 3.0E-13 | 76 | 146 | No hit | No description |
SMART | SM00338 | 2.2E-4 | 77 | 145 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF07716 | 1.0E-12 | 80 | 127 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 8.565 | 80 | 127 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 6.0E-6 | 84 | 127 | No hit | No description |
CDD | cd14686 | 9.88E-10 | 90 | 127 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 194 aa Download sequence Send to blast |
MDDVSSEVSD KLSDNLFSNP ESCSNFQAST SLNTVTELSK NTTKTCTHTH TCNPPGPDEA 60 IHTHTCFHTH TQVFASEDDT NSRPKRTSGN REAVKKYREK KKAQTAYLEE EVKKLKMLNQ 120 QLLRKLQGQA LLEAELLRLR KVFVQLKGKI DSELGSFPFQ KQCFSSSVYK GDANLVSTSQ 180 PVDLELCSTE TSD* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor involved in the regulation of salt stress response. Functions as a negative transcriptional regulator of salt stress acclimation response by regulating cation homeostasis (PubMed:18703123, PubMed:19248824). Regulates negatively the expression of genes contributing to ion and osmotic homeostasis during salt stress, such as the Na(+) transporter HKT1, the Na(+)/H(+) antiporter SOS1, the aquaporin PIP2-1 and the glutamine synthetase GLN1-3. In addition, targets genes with functions in plant growth and development, such as argonaute 4 (AGO4) and cyclophilin 19 (CYP19) (PubMed:19248824). {ECO:0000269|PubMed:18703123, ECO:0000269|PubMed:19248824}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Tp57577_TGAC_v2_mRNA2786 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by salt stress (PubMed:18703123, PubMed:19248824). Induced by osmotic stress (PubMed:19248824). {ECO:0000269|PubMed:18703123, ECO:0000269|PubMed:19248824}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | EF691549 | 1e-38 | EF691549.1 Trifolium repens clone CloverSSR-6_F09_035_1 microsatellite sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_007149027.1 | 2e-82 | hypothetical protein PHAVU_005G034400g | ||||
Refseq | XP_007149028.1 | 2e-82 | hypothetical protein PHAVU_005G034400g | ||||
Swissprot | Q8GTS1 | 2e-51 | BZP24_ARATH; Basic leucine zipper 24 | ||||
TrEMBL | A0A2K3PMN8 | 1e-139 | A0A2K3PMN8_TRIPR; Basic leucine zipper 24 transcription factor | ||||
STRING | XP_007149027.1 | 9e-82 | (Phaseolus vulgaris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF2567 | 32 | 77 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G51960.2 | 6e-34 | basic leucine zipper 24 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Tp57577_TGAC_v2_mRNA2786 |