PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Tp3g10980 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 229aa MW: 26062.2 Da PI: 7.8155 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 46.7 | 7.1e-15 | 16 | 63 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+W+ eE e+l+ + + G +W++ ++ g++R++k+c++rw +yl Tp3g10980 16 RGPWSDEESEKLKAFILKNGHCNWRSLPKLAGLKRCGKSCRLRWINYL 63 89********************************************97 PP | |||||||
2 | Myb_DNA-binding | 56.2 | 8e-18 | 69 | 114 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg++T+eE++ ++++++ +G++ W++Ia++++ gRt++++k+ w+++l Tp3g10980 69 RGNFTKEEEDTIIHLHQAHGNK-WSKIASHLP-GRTDNEIKNVWNTHL 114 89********************.*********.************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 13.361 | 11 | 63 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 6.74E-29 | 14 | 110 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 6.3E-11 | 15 | 65 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 8.3E-13 | 16 | 63 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 9.8E-21 | 17 | 70 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 8.51E-8 | 18 | 63 | No hit | No description |
PROSITE profile | PS51294 | 25.712 | 64 | 118 | IPR017930 | Myb domain |
SMART | SM00717 | 3.4E-16 | 68 | 116 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 9.2E-17 | 69 | 114 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.0E-28 | 71 | 119 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.55E-11 | 71 | 114 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 229 aa Download sequence Send to blast |
MGQRRTPCCD STQVKRGPWS DEESEKLKAF ILKNGHCNWR SLPKLAGLKR CGKSCRLRWI 60 NYLRPGLKRG NFTKEEEDTI IHLHQAHGNK WSKIASHLPG RTDNEIKNVW NTHLKKRLIK 120 SNSSASDVTN QASSISSSSS SSSSISSVSN NVINRGKHNQ EEEFEEILVE DMACGFEVNA 180 PQSLEFLFQD QQIPPPPISK PEHELCSRMV EPGLDDYNEW LNYLDNQTL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 8e-23 | 16 | 118 | 7 | 108 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Involved in metal ions homeostasis, including iron ions (Fe) acquisition, via the regulation of NAS4 and NAS2 genes expression. Necessary for plant survival in alkaline soil where iron availability is greatly restricted. Triggers tolerance to nickel (Ni) and zinc (Zn) ions. {ECO:0000269|PubMed:24278034}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00352 | DAP | Transfer from AT3G12820 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Tp3g10980 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Accumulates strongly in the root stele and in the outer layers of the lateral roots when exposed to iron (Fe)-deficient conditions (PubMed:24278034). Slightly induced by ethylene and by darkness conditions (PubMed:9839469). Accumulates upon potassium (K) depletion (PubMed:15489280). Induced by zinc (Zn) and cadmium (Cd) ions (PubMed:18088336). {ECO:0000269|PubMed:15489280, ECO:0000269|PubMed:18088336, ECO:0000269|PubMed:24278034, ECO:0000269|PubMed:9839469}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006407290.1 | 1e-133 | transcription factor MYB10 | ||||
Swissprot | Q9LTV4 | 1e-115 | MYB10_ARATH; Transcription factor MYB10 | ||||
TrEMBL | V4M8N3 | 1e-132 | V4M8N3_EUTSA; Uncharacterized protein | ||||
STRING | XP_006407290.1 | 1e-133 | (Eutrema salsugineum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM14096 | 16 | 24 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G12820.1 | 1e-113 | myb domain protein 10 |
Publications ? help Back to Top | |||
---|---|---|---|
|