PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Tp1g26970 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 248aa MW: 28730.7 Da PI: 7.715 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 73 | 2.4e-23 | 11 | 58 | 3 | 50 |
--SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS SRF-TF 3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 e+k +rqvtf+kR++ ++KKA+ELS+LCd+ v +iifs+++kly + Tp1g26970 11 LEDKVKRQVTFAKRKKSLMKKAHELSILCDVPVGLIIFSQSDKLYAFN 58 699******************************************996 PP | |||||||
2 | K-box | 39.2 | 2.9e-14 | 88 | 161 | 12 | 85 |
K-box 12 akaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkek 85 + +++++ + + +ei+nL+ ++R + G +L+ L++ eL + e qL +sl++ R++K el+++q ++ k k Tp1g26970 88 DHKSNCEETKESMIREIDNLKMNLRLYGGHGLNLLTYDELLRFELQLASSLQNARARKFELMHQQQQTDESKAK 161 45566677778999*************************************************98776544433 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 25.175 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 1.6E-27 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.84E-31 | 2 | 79 | No hit | No description |
SuperFamily | SSF55455 | 4.32E-25 | 3 | 76 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.4E-21 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 4.4E-22 | 11 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.4E-21 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.4E-21 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 1.4E-8 | 89 | 173 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 10.485 | 90 | 189 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0030308 | Biological Process | negative regulation of cell growth | ||||
GO:0048510 | Biological Process | regulation of timing of transition from vegetative to reproductive phase | ||||
GO:0048530 | Biological Process | fruit morphogenesis | ||||
GO:0080060 | Biological Process | integument development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 248 aa Download sequence Send to blast |
MRKGKVVIQK LEDKVKRQVT FAKRKKSLMK KAHELSILCD VPVGLIIFSQ SDKLYAFNSH 60 STSMENLIMR YQMAKEGHAA AVNSFHPDHK SNCEETKESM IREIDNLKMN LRLYGGHGLN 120 LLTYDELLRF ELQLASSLQN ARARKFELMH QQQQTDESKA KGKEILMDEE NQQFYHPGQG 180 SSWEHLMWQA ERQMMTCQKE EDDDVIRRQV KEEFPFYGDE HPTGFLQLLG TPPQSPSPSN 240 PDPKSGFK |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 9e-17 | 1 | 84 | 1 | 82 | MEF2C |
5f28_B | 9e-17 | 1 | 84 | 1 | 82 | MEF2C |
5f28_C | 9e-17 | 1 | 84 | 1 | 82 | MEF2C |
5f28_D | 9e-17 | 1 | 84 | 1 | 82 | MEF2C |
6byy_A | 1e-16 | 1 | 84 | 1 | 82 | MEF2 CHIMERA |
6byy_B | 1e-16 | 1 | 84 | 1 | 82 | MEF2 CHIMERA |
6byy_C | 1e-16 | 1 | 84 | 1 | 82 | MEF2 CHIMERA |
6byy_D | 1e-16 | 1 | 84 | 1 | 82 | MEF2 CHIMERA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in the regulation of fruit growth. Contributes to integument development. Controls organ size via cell expansion (PubMed:20088901). Involved in the regulation of longitudinal growth of the fruit evenly throughout the radial axis (PubMed:20598091). Functions redundantly with TT16/AGL32 to repress nucellus growth and promote its degeneration (PubMed:27233529). {ECO:0000269|PubMed:20088901, ECO:0000269|PubMed:20598091, ECO:0000269|PubMed:27233529}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00172 | DAP | Transfer from AT1G31140 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Tp1g26970 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | - | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006306362.2 | 1e-102 | agamous-like MADS-box protein AGL63 | ||||
Swissprot | Q9SA07 | 4e-89 | AGL63_ARATH; Agamous-like MADS-box protein AGL63 | ||||
TrEMBL | A0A0D3CF40 | 1e-136 | A0A0D3CF40_BRAOL; Uncharacterized protein | ||||
STRING | Bo5g065750.1 | 1e-137 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM16860 | 9 | 10 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G31140.2 | 8e-91 | GORDITA |
Publications ? help Back to Top | |||
---|---|---|---|
|