PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Sopen12g012630.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 195aa MW: 22114.2 Da PI: 6.1208 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 175.5 | 5.4e-55 | 28 | 123 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrele 94 +eqdrflPianv+rimkkv+P+n+kiskdaketvqecvsefisfvt+easdkcqrekrktingdd++wa++ lGfedyv plk+yl+kyrele Sopen12g012630.1 28 KEQDRFLPIANVGRIMKKVIPGNGKISKDAKETVQECVSEFISFVTGEASDKCQREKRKTINGDDIIWAITILGFEDYVLPLKQYLNKYRELE 120 89******************************************************************************************* PP NF-YB 95 gek 97 gek Sopen12g012630.1 121 GEK 123 996 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 5.0E-51 | 27 | 137 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 2.64E-39 | 30 | 136 | IPR009072 | Histone-fold |
Pfam | PF00808 | 3.4E-28 | 33 | 97 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 1.9E-18 | 61 | 79 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 64 | 80 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 1.9E-18 | 80 | 98 | No hit | No description |
PRINTS | PR00615 | 1.9E-18 | 99 | 117 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 195 aa Download sequence Send to blast |
MEDERGGNCA ESSSSTLMPM PMPMPMNKEQ DRFLPIANVG RIMKKVIPGN GKISKDAKET 60 VQECVSEFIS FVTGEASDKC QREKRKTING DDIIWAITIL GFEDYVLPLK QYLNKYRELE 120 GEKLNVPKHV NQQQQQHAAD QIKPNFSYNT TTTVYSPTPL LPQTSFVPTD QPFPLPFSPN 180 SQLPKQEHLD SMGHW |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 4e-43 | 28 | 118 | 2 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 4e-43 | 28 | 118 | 2 | 92 | Transcription factor HapC (Eurofung) |
5g49_A | 4e-43 | 28 | 118 | 7 | 97 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HG975451 | 0.0 | HG975451.1 Solanum pennellii chromosome ch12, complete genome. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015060873.2 | 1e-146 | nuclear transcription factor Y subunit B-7 | ||||
Swissprot | Q9SIT9 | 1e-67 | NFYB7_ARATH; Nuclear transcription factor Y subunit B-7 | ||||
TrEMBL | K4DDT5 | 1e-134 | K4DDT5_SOLLC; Uncharacterized protein | ||||
STRING | Solyc12g027650.1.1 | 1e-135 | (Solanum lycopersicum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA111 | 24 | 356 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G13570.1 | 3e-68 | nuclear factor Y, subunit B7 |
Publications ? help Back to Top | |||
---|---|---|---|
|