PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Solyc05g012050.2.1

Common Name

LOC101262914

Organism

Solanum lycopersicum

Taxonomic ID

4081

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon

Family

YABBY

Protein Properties

Length: 159aa MW: 17732.1 Da PI: 9.0774

Description

YABBY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Solyc05g012050.2.1	genome	ITAG	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	YABBY	150.6	1.5e-46	2	145	2	163
YABBY 2 dvfssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakasqllaaeshldeslkeelleelkveeenlksnvekeesa 92 d ++sse++Cyv+CnfCnt+lav +P++ l+ +vtv+CGhC++l ++ + +++ + +++ n++ + ++ +++ Solyc05g012050.2.1 2 DYVQSSEHLCYVRCNFCNTVLAVGIPYKRLMDTVTVKCGHCSNLSFLTTRP-----------------PIQGQCFDHQPNIQGYCSELKNK 75 7789************************************985543333.................23333344444444444444443 PP YABBY 93 stsvsseklsenedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahf 163 + ss++ s++++ +p++p v++PPek+ r Psaynrf+keeiqrik++nP+i hreafsaaaknWa + Solyc05g012050.2.1 76 GQASSSTS-STSSEPLSPKAPFVVKPPEKKHRLPSAYNRFMKEEIQRIKSENPEIPHREAFSAAAKNWARY 145 33333322.566777899999**********************************************75 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF04690	7.4E-54	6	145	IPR006780	YABBY protein
SuperFamily	SSF47095	3.01E-9	89	144	IPR009071	High mobility group box domain
Gene3D	G3DSA:1.10.30.10	8.6E-6	99	144	IPR009071	High mobility group box domain
CDD	cd01390	2.52E-6	106	142	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0010254	Biological Process	nectary development
GO:0010582	Biological Process	floral meristem determinacy
GO:0048479	Biological Process	style development

Sequence ? help Back to Top
Protein Sequence Length: 159 aa Download sequence Send to blast
MDYVQSSEHL CYVRCNFCNT VLAVGIPYKR LMDTVTVKCG HCSNLSFLTT RPPIQGQCFD 60 HQPNIQGYCS ELKNKGQASS STSSTSSEPL SPKAPFVVKP PEKKHRLPSA YNRFMKEEIQ 120 RIKSENPEIP HREAFSAAAK NWARYLPNPP NSGNTNNV*

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Les.10363	0.0	flower

Expression -- Microarray ? help Back to Top
Source	ID	E-value
GEO	4381202	0.0

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Detected during flower and leaf development. Expression in the flower meristem in the early stage of flower development. When carpel primordia begin to form, specific and uniform expression in carpel primordia. Expression in the central region of the leaf plastochron 1 (P1) primordia. Detected up to P4 stage, hardly detected in the P5 leaves. {ECO:0000269\|PubMed:14729915}.

Functional Description ? help Back to Top
Source	Description
UniProt	Regulates carpel specification in flower development. Severe or intermediate mutation in DL causes complete or partial homeotic conversion of carpels into stamens without affecting the identities of other floral organs. Interacts antagonistically with class B genes and controls floral meristem determinacy. Regulates midrib formation in leaves probably by inducing cell proliferation in the central region of the leaf. {ECO:0000269\|PubMed:14729915}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00220	DAP	Transfer from AT1G69180	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Solyc05g012050.2.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_004239032.1	1e-116	protein CRABS CLAW isoform X2
Swissprot	Q76EJ0	1e-61	YABDL_ORYSJ; Protein DROOPING LEAF
TrEMBL	A0A3Q7GFI6	1e-115	A0A3Q7GFI6_SOLLC; Uncharacterized protein
STRING	Solyc05g012050.2.1	1e-116	(Solanum lycopersicum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA5210	23	39
Representative plant	OGRP9069	11	14

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G69180.1	3e-61	YABBY family protein

Link Out ? help Back to Top
Phytozome	Solyc05g012050.2.1
Entrez Gene	101262914

Publications ? help Back to Top
Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments. Theor. Appl. Genet., 2005. 112(1): p. 72-84 [PMID:16208505]