PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Solyc04g049910.2.1 | ||||||||
Common Name | LOC101251575 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 166aa MW: 17776.8 Da PI: 4.8585 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 177.9 | 9.6e-56 | 27 | 122 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyre 92 reqdr+lPian++rimkk+lPan+ki+kd+k+tvqecvsefisf+tseasdkcq+ekrktingddll alatlGfedy+eplkvyl++yre Solyc04g049910.2.1 27 REQDRYLPIANIGRIMKKALPANGKIAKDSKDTVQECVSEFISFITSEASDKCQKEKRKTINGDDLLSALATLGFEDYIEPLKVYLTRYRE 117 89***************************************************************************************** PP NF-YB 93 legek 97 +eg+ Solyc04g049910.2.1 118 MEGDA 122 ***96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 7.6E-52 | 23 | 126 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 1.43E-38 | 29 | 124 | IPR009072 | Histone-fold |
Pfam | PF00808 | 2.9E-27 | 32 | 96 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 4.7E-20 | 60 | 78 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 63 | 79 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 4.7E-20 | 79 | 97 | No hit | No description |
PRINTS | PR00615 | 4.7E-20 | 98 | 116 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 166 aa Download sequence Send to blast |
MAEPASPGGG GGSHESGGDP SPQSNLREQD RYLPIANIGR IMKKALPANG KIAKDSKDTV 60 QECVSEFISF ITSEASDKCQ KEKRKTINGD DLLSALATLG FEDYIEPLKV YLTRYREMEG 120 DAKGSARVGD ASVRKDVVGC QLGSNTQFMY EGSFAQGLDY GNSQL* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 9e-47 | 26 | 117 | 1 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 9e-47 | 26 | 117 | 1 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in flowers and mature rosettes. {ECO:0000269|PubMed:11250072}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Solyc04g049910.2.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | CU457806 | 1e-121 | S.lycopersicum DNA sequence from clone SL_MboI-28J22 on chromosome 4, complete sequence |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004237524.1 | 1e-119 | nuclear transcription factor Y subunit B-10-like | ||||
Refseq | XP_010319840.1 | 1e-119 | nuclear transcription factor Y subunit B-10-like | ||||
Refseq | XP_025886490.1 | 1e-119 | nuclear transcription factor Y subunit B-10-like | ||||
Swissprot | Q8VYK4 | 4e-75 | NFYB8_ARATH; Nuclear transcription factor Y subunit B-8 | ||||
TrEMBL | A0A0V0I0W4 | 1e-117 | A0A0V0I0W4_SOLCH; Putative transcription factor NF-Y CCAAT-binding-like protein-like | ||||
TrEMBL | Q2XTB9 | 1e-117 | Q2XTB9_SOLTU; Transcription factor NF-Y CCAAT-binding-like protein-like | ||||
STRING | Solyc04g049910.2.1 | 1e-119 | (Solanum lycopersicum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA111 | 24 | 356 | Representative plant | OGRP168 | 17 | 170 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G53340.1 | 4e-72 | nuclear factor Y, subunit B10 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Solyc04g049910.2.1 |
Entrez Gene | 101251575 |
Publications ? help Back to Top | |||
---|---|---|---|
|