PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Solyc02g084420.2.1

Organism

Solanum lycopersicum

Taxonomic ID

4081

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon

Family

DBB

Protein Properties

Length: 89aa MW: 9572.16 Da PI: 5.5724

Description

DBB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Solyc02g084420.2.1	genome	ITAG	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	zf-B_box	26.1	1.8e-08	4	33	5	34
zf-B_box 5 kCpeHeekelqlfCedCqqllCedClleeH 34 C+ +e+ ++lfC ++ lC+ C ++ H Solyc02g084420.2.1 4 LCDVCESAAAILFCAADEAALCRACDEKVH 33 7**************************999 PP
2	zf-B_box	28.7	2.8e-09	52	84	2	34
zf-B_box 2 eerkCpeHeekelqlfCedCqqllCedClleeH 34 e ++C+ +e+ ++ ++Ce +++ lC +C + H Solyc02g084420.2.1 52 EVPRCDICENSPAFFYCEVDGSSLCLQCDMMVH 84 789**************************9888 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00336	1.3E-8	1	47	IPR000315	B-box-type zinc finger
PROSITE profile	PS50119	10.139	1	47	IPR000315	B-box-type zinc finger
CDD	cd00021	3.40E-5	3	45	No hit	No description
Pfam	PF00643	7.4E-7	3	42	IPR000315	B-box-type zinc finger
SuperFamily	SSF57845	6.64E-5	48	85	No hit	No description
PROSITE profile	PS50119	9.129	51	88	IPR000315	B-box-type zinc finger
SMART	SM00336	2.9E-4	51	88	IPR000315	B-box-type zinc finger
Pfam	PF00643	1.1E-7	51	84	IPR000315	B-box-type zinc finger
CDD	cd00021	1.70E-5	54	84	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0009640	Biological Process	photomorphogenesis
GO:0005634	Cellular Component	nucleus
GO:0000989	Molecular Function	transcription factor activity, transcription factor binding
GO:0008270	Molecular Function	zinc ion binding

Sequence ? help Back to Top
Protein Sequence Length: 89 aa Download sequence Send to blast
MRTLCDVCES AAAILFCAAD EAALCRACDE KVHMCNKLAS RHVRVGIAKP NEVPRCDICE 60 NSPAFFYCEV DGSSLCLQCD MMVHVGGK*

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Les.1219	1e-148	fruit\| leaf

Functional Description ? help Back to Top
Source	Description
UniProt	Acts as negative regulator of seedling photomorphogenesis. {ECO:0000269\|PubMed:18540109}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Solyc02g084420.2.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AC232776	8e-49	Solanum lycopersicum chromosome 2 clone C02SLm0132H19, complete sequence

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_015066178.1	4e-59	B-box zinc finger protein 19-like
Swissprot	C0SVM5	3e-50	BBX19_ARATH; B-box zinc finger protein 19
TrEMBL	A0A3Q7F718	2e-57	A0A3Q7F718_SOLLC; Uncharacterized protein
TrEMBL	M0ZW20	3e-56	M0ZW20_SOLTU; B-box zinc finger protein 23
STRING	Solyc02g084420.2.1	4e-58	(Solanum lycopersicum)
STRING	PGSC0003DMT400009328	4e-57	(Solanum tuberosum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA3175	23	40
Representative plant	OGRP3352	16	28

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G38960.1	1e-52	DBB family protein

Link Out ? help Back to Top
Phytozome	Solyc02g084420.2.1

Publications ? help Back to Top
Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments. Theor. Appl. Genet., 2005. 112(1): p. 72-84 [PMID:16208505]