PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc02g083520.2.1
Common NameSPGB
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family bZIP
Protein Properties Length: 218aa    MW: 24273.8 Da    PI: 10.0935
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc02g083520.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_153.26.3e-17147199456
                         XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkev 56 
                         ++r  r++kNRe+A rsR+RK+a++ eLe +v+ L +eN +Lkk+ ++l+  +
  Solyc02g083520.2.1 147 DRRNQRMIKNRESAARSRARKQAYMNELESEVAHLVEENARLKKQQQQLRVDA 199
                         68999****************************************99998655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.1E-15144208IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.392146196IPR004827Basic-leucine zipper domain
PfamPF001702.5E-14148196IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.9E-15148197No hitNo description
CDDcd147078.57E-22148195No hitNo description
SuperFamilySSF579594.91E-12148196No hitNo description
PROSITE patternPS000360152166IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009911Biological Processpositive regulation of flower development
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000028Biological Processregulation of photoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0043621Molecular Functionprotein self-association
Sequence ? help Back to Top
Protein Sequence    Length: 218 aa     Download sequence    Send to blast
MWSSSSDNRG LSASSSSSSS SSHSPFSPRL KTMEEVWKDI NLSSLQDHTT NYSRDHHHLH  60
DHNHQAANFG GMILQDFLAR PFANESSPAA AAAAASPVSA TTMLNLNSVP ELHFFDNPLR  120
QNSILHQPNA SGRKRVVPET EDNSTGDRRN QRMIKNRESA ARSRARKQAY MNELESEVAH  180
LVEENARLKK QQQQLRVDAA NQVPKKNTLY RTSTAPF*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.193180.0stem
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Highly expressed in shoot apex. {ECO:0000269|PubMed:16099979, ECO:0000269|PubMed:16099980, ECO:0000269|PubMed:25661797}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor required for the transition to flowering promoted by FT. {ECO:0000269|PubMed:16099979, ECO:0000269|PubMed:16099980}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc02g083520.2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1369190.0Solanum lycopersicum self-pruning G-box protein (SPGB) mRNA, complete cds
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001234345.11e-159self-pruning G-box protein
SwissprotQ84JK21e-39FD_ARATH; Protein FD
TrEMBLA1YTV01e-158A1YTV0_SOLLC; Self-pruning G-box protein
STRINGSolyc02g083520.2.11e-159(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA35722239
Representative plantOGRP8739610
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35900.11e-36bZIP family protein
Publications ? help Back to Top
  1. Pnueli L, et al.
    Tomato SP-interacting proteins define a conserved signaling system that regulates shoot architecture and flowering.
    Plant Cell, 2001. 13(12): p. 2687-702
    [PMID:11752381]
  2. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]
  3. Lifschitz E, et al.
    The tomato FT ortholog triggers systemic signals that regulate growth and flowering and substitute for diverse environmental stimuli.
    Proc. Natl. Acad. Sci. U.S.A., 2006. 103(16): p. 6398-403
    [PMID:16606827]
  4. Ho WW,Weigel D
    Structural features determining flower-promoting activity of Arabidopsis FLOWERING LOCUS T.
    Plant Cell, 2014. 26(2): p. 552-64
    [PMID:24532592]
  5. Ji H, et al.
    Downregulation of leaf flavin content induces early flowering and photoperiod gene expression in Arabidopsis.
    BMC Plant Biol., 2014. 14: p. 237
    [PMID:25201173]
  6. Li L, et al.
    Expression of turtle riboflavin-binding protein represses mitochondrial electron transport gene expression and promotes flowering in Arabidopsis.
    BMC Plant Biol., 2014. 14: p. 381
    [PMID:25547226]
  7. Sussmilch FC, et al.
    Pea VEGETATIVE2 Is an FD Homolog That Is Essential for Flowering and Compound Inflorescence Development.
    Plant Cell, 2015. 27(4): p. 1046-60
    [PMID:25804541]
  8. Khan M, et al.
    Repression of Lateral Organ Boundary Genes by PENNYWISE and POUND-FOOLISH Is Essential for Meristem Maintenance and Flowering in Arabidopsis.
    Plant Physiol., 2015. 169(3): p. 2166-86
    [PMID:26417006]
  9. Andrés F, et al.
    Floral Induction in Arabidopsis by FLOWERING LOCUS T Requires Direct Repression of BLADE-ON-PETIOLE Genes by the Homeodomain Protein PENNYWISE.
    Plant Physiol., 2015. 169(3): p. 2187-99
    [PMID:26417007]
  10. Kawamoto N,Endo M,Araki T
    Expression of a kinase-dead form of CPK33 involved in florigen complex formation causes delayed flowering.
    Plant Signal Behav, 2015. 10(12): p. e1086856
    [PMID:26440648]
  11. Zhang L,Yu H,Lin S,Gao Y
    Molecular Characterization of FT and FD Homologs from Eriobotrya deflexa Nakai forma koshunensis.
    Front Plant Sci, 2016. 7: p. 8
    [PMID:26834775]
  12. Hou CJ,Yang CH
    Comparative analysis of the pteridophyte Adiantum MFT ortholog reveals the specificity of combined FT/MFT C and N terminal interaction with FD for the regulation of the downstream gene AP1.
    Plant Mol. Biol., 2016. 91(4-5): p. 563-79
    [PMID:27216814]
  13. Jung JH,Lee HJ,Ryu JY,Park CM
    SPL3/4/5 Integrate Developmental Aging and Photoperiodic Signals into the FT-FD Module in Arabidopsis Flowering.
    Mol Plant, 2016. 9(12): p. 1647-1659
    [PMID:27815142]
  14. Jang S,Li HY,Kuo ML
    Ectopic expression of Arabidopsis FD and FD PARALOGUE in rice results in dwarfism with size reduction of spikelets.
    Sci Rep, 2017. 7: p. 44477
    [PMID:28290557]