PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Sobic.009G239600.2.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 138aa MW: 15272.5 Da PI: 5.317 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 167.8 | 1.3e-52 | 15 | 107 | 2 | 94 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkky 90 +eqdrflPian++rim++++P+n+ki+kd+ke++qecvsefisf+tseasdkc +e+rktingdd++w+l+tlGfe+yveplk+ylk+y Sobic.009G239600.2.p 15 KEQDRFLPIANIGRIMRRAVPENGKIAKDSKESIQECVSEFISFITSEASDKCMKERRKTINGDDIIWSLGTLGFEEYVEPLKIYLKNY 103 89*************************************************************************************** PP NF-YB 91 rele 94 re+ Sobic.009G239600.2.p 104 REVS 107 **96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 1.1E-47 | 14 | 106 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 1.16E-36 | 17 | 107 | IPR009072 | Histone-fold |
Pfam | PF00808 | 6.6E-26 | 20 | 83 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 8.7E-20 | 48 | 66 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 51 | 67 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 8.7E-20 | 67 | 85 | No hit | No description |
PRINTS | PR00615 | 8.7E-20 | 86 | 104 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 138 aa Download sequence Send to blast |
MSEAEAACGG GGGGKEQDRF LPIANIGRIM RRAVPENGKI AKDSKESIQE CVSEFISFIT 60 SEASDKCMKE RRKTINGDDI IWSLGTLGFE EYVEPLKIYL KNYREVSFNS NLPLSSSSCY 120 WVFIIIVFKR EGTICGV* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1n1j_A | 2e-44 | 15 | 105 | 3 | 93 | NF-YB |
4awl_B | 2e-44 | 15 | 105 | 4 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
4csr_A | 2e-44 | 15 | 105 | 4 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:14617083}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. May regulate the expression of photosynthetic genes, and may be involved in chloroplast and amyloplast development. {ECO:0000269|PubMed:14617083}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Sobic.009G239600.2.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KM078742 | 1e-100 | KM078742.1 Triticum aestivum CCAAT-binding transcription factor A (NFYB-D11) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021302582.1 | 4e-72 | nuclear transcription factor Y subunit B-4 | ||||
Refseq | XP_021302583.1 | 4e-72 | nuclear transcription factor Y subunit B-4 | ||||
Swissprot | Q65XK1 | 4e-57 | NFYB4_ORYSJ; Nuclear transcription factor Y subunit B-4 | ||||
TrEMBL | A0A1Z5R4V8 | 4e-95 | A0A1Z5R4V8_SORBI; Uncharacterized protein | ||||
STRING | Sb09g029140.1 | 5e-71 | (Sorghum bicolor) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP201 | 38 | 331 | Representative plant | OGRP168 | 17 | 170 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G38880.6 | 4e-52 | nuclear factor Y, subunit B1 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Sobic.009G239600.2.p |
Publications ? help Back to Top | |||
---|---|---|---|
|