PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Sme2.5_05467.1_g00001.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
|
||||||||
Family | SBP | ||||||||
Protein Properties | Length: 136aa MW: 15783.6 Da PI: 7.8603 | ||||||||
Description | SBP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SBP | 138.4 | 2e-43 | 52 | 127 | 2 | 77 |
-SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS SBP 2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 Cqve+C ad+++ak yhrrhkvCe+hsk+p vl+ gl+qrfCqqCsrfh l+efDe+krsCrrrLa+hnerrrk + Sme2.5_05467.1_g00001.1 52 CQVEQCPADMTNAKPYHRRHKVCEFHSKSPIVLIGGLQQRFCQQCSRFHLLEEFDEAKRSCRRRLADHNERRRKIT 127 *************************************************************************976 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PIRSF | PIRSF037575 | 8.6E-55 | 1 | 136 | IPR017238 | Squamosa promoter-binding protein |
Gene3D | G3DSA:4.10.1100.10 | 3.5E-36 | 44 | 113 | IPR004333 | Transcription factor, SBP-box |
PROSITE profile | PS51141 | 32.317 | 49 | 126 | IPR004333 | Transcription factor, SBP-box |
SuperFamily | SSF103612 | 4.19E-40 | 50 | 129 | IPR004333 | Transcription factor, SBP-box |
Pfam | PF03110 | 4.9E-33 | 52 | 125 | IPR004333 | Transcription factor, SBP-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009911 | Biological Process | positive regulation of flower development | ||||
GO:0010228 | Biological Process | vegetative to reproductive phase transition of meristem | ||||
GO:0010229 | Biological Process | inflorescence development | ||||
GO:0010321 | Biological Process | regulation of vegetative phase change | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 136 aa Download sequence Send to blast |
METNKWEGKR SINEAEEEED EHESVEEDSK RKRVLTLSGR KLSGGGSAHP SCQVEQCPAD 60 MTNAKPYHRR HKVCEFHSKS PIVLIGGLQQ RFCQQCSRFH LLEEFDEAKR SCRRRLADHN 120 ERRRKITYDS PGESLS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ul4_A | 1e-36 | 43 | 125 | 2 | 84 | squamosa promoter binding protein-like 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcriptional factor. Binds to the promoter of the SQUAMOSA gene. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00290 | DAP | Transfer from AT2G33810 | Download |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | EF141196 | 1e-154 | EF141196.1 Capsicum annuum squamosa promoter binding protein-like protein mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001306237.1 | 2e-83 | SQUAMOSA promoter binding protein-like | ||||
Refseq | XP_015063347.1 | 2e-83 | squamosa promoter-binding protein 1 isoform X1 | ||||
Swissprot | Q38741 | 8e-56 | SBP1_ANTMA; Squamosa promoter-binding protein 1 | ||||
TrEMBL | Q0PY35 | 5e-82 | Q0PY35_SOLLC; Squamosa promoter-binding-like protein | ||||
STRING | Solyc02g077920.2.1 | 9e-83 | (Solanum lycopersicum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA749 | 24 | 105 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G33810.1 | 3e-43 | squamosa promoter binding protein-like 3 |
Publications ? help Back to Top | |||
---|---|---|---|
|