![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Sme2.5_00343.1_g00010.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 82aa MW: 9680.2 Da PI: 10.4679 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 50 | 6.7e-16 | 8 | 55 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+W eEd++l+ +v lG ++W++ a+ g++R++k+c++rw +yl Sme2.5_00343.1_g00010.1 8 KGPWLDEEDDRLAYVVSILGDRRWDALAKASGLRRSGKSCRLRWMNYL 55 79*********************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 21.378 | 1 | 59 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 4.3E-18 | 3 | 58 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.0E-11 | 7 | 57 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 6.7E-14 | 8 | 55 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 2.01E-18 | 9 | 82 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 4.54E-8 | 10 | 55 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 5.1E-7 | 59 | 82 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 82 aa Download sequence Send to blast |
MQEVKLRKGP WLDEEDDRLA YVVSILGDRR WDALAKASGL RRSGKSCRLR WMNYLRPNLK 60 HGHITQDEEH LIIKLQKQLG NK |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1gv2_A | 7e-14 | 6 | 82 | 2 | 77 | MYB PROTO-ONCOGENE PROTEIN |
1mse_C | 8e-14 | 6 | 82 | 2 | 77 | C-Myb DNA-Binding Domain |
1msf_C | 8e-14 | 6 | 82 | 2 | 77 | C-Myb DNA-Binding Domain |
Search in ModeBase |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Accumulates in etiolated seedlings in dark conditions. {ECO:0000269|PubMed:9839469}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HG975448 | 8e-56 | HG975448.1 Solanum pennellii chromosome ch09, complete genome. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015086827.1 | 2e-50 | transcription factor MYB27-like | ||||
Swissprot | Q9SCP1 | 2e-31 | MYB27_ARATH; Transcription factor MYB27 | ||||
TrEMBL | A0A3Q7HYP8 | 4e-49 | A0A3Q7HYP8_SOLLC; Uncharacterized protein | ||||
STRING | Solyc09g008390.1.1 | 5e-50 | (Solanum lycopersicum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA12 | 24 | 2154 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G53200.1 | 9e-34 | myb domain protein 27 |
Publications ? help Back to Top | |||
---|---|---|---|
|