PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Seita.5G393800.1.p | ||||||||
Common Name | SETIT_003247mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 148aa MW: 16539.9 Da PI: 10.6858 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 45.7 | 1.4e-14 | 65 | 109 | 3 | 47 |
XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkk 47 + +r++r++kNRe+A rsR+RK+a+i+eLe v +Le+eN +L Seita.5G393800.1.p 65 AMQRQKRMIKNRESAARSRERKQAYIAELESLVTQLEEENAELLR 109 689*************************************98753 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 1.2E-8 | 63 | 125 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 10.415 | 65 | 107 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF00170 | 1.0E-13 | 65 | 119 | IPR004827 | Basic-leucine zipper domain |
CDD | cd14707 | 7.42E-16 | 67 | 117 | No hit | No description |
SuperFamily | SSF57959 | 5.63E-11 | 68 | 112 | No hit | No description |
Gene3D | G3DSA:1.20.5.170 | 2.3E-14 | 68 | 123 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 70 | 85 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 148 aa Download sequence Send to blast |
MTLEDFLARE GAVKEDEARI SGPSAPAEGQ VVMGFLGGAE GVGVAGGGGG RGRKRQLMDP 60 VDRAAMQRQK RMIKNRESAA RSRERKQAYI AELESLVTQL EEENAELLRG QEERHQKRLK 120 ELLERVTPVI VRKKLSRDLR RTNSMQW* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that binds to the ABA-responsive elements (ABREs) in vitro. Involved in abiotic stress responses and abscisic acid (ABA) signaling (PubMed:20039193). Involved in the signaling pathway that induces growth inhibition in response to D-allose (PubMed:23397192). {ECO:0000269|PubMed:20039193, ECO:0000269|PubMed:23397192}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Seita.5G393800.1.p |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by anoxia, drought, salt stress, oxidative stress, cold and abscisic acid (ABA) (PubMed:20039193). Induced by D-allose (PubMed:23397192). {ECO:0000269|PubMed:20039193, ECO:0000269|PubMed:23397192}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT054149 | 1e-136 | BT054149.1 Zea mays full-length cDNA clone ZM_BFb0134E03 mRNA, complete cds. | |||
GenBank | BT055944 | 1e-136 | BT055944.1 Zea mays full-length cDNA clone ZM_BFc0058E14 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012702071.2 | 1e-99 | LOW QUALITY PROTEIN: G-box-binding factor 4-like | ||||
Swissprot | Q0JHF1 | 1e-74 | BZP12_ORYSJ; bZIP transcription factor 12 | ||||
TrEMBL | K3XMX4 | 4e-99 | K3XMX4_SETIT; Uncharacterized protein | ||||
STRING | Si003247m | 1e-100 | (Setaria italica) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP2665 | 37 | 86 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G03970.1 | 2e-28 | G-box binding factor 4 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Seita.5G393800.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|