PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | SapurV1A.0260s0250.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
|
||||||||
Family | GRF | ||||||||
Protein Properties | Length: 169aa MW: 18868.8 Da PI: 10.3494 | ||||||||
Description | GRF family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRC | 58.6 | 1.1e-18 | 136 | 168 | 1 | 33 |
WRC 1 daepgrCrRtDGKkWRCsrrvlegkklCErHlh 33 ++epgrCrRtDGKkWRCs++vl+ +k+C++H+h SapurV1A.0260s0250.1.p 136 EPEPGRCRRTDGKKWRCSKEVLPCQKYCDKHIH 168 69*****************************98 PP | |||||||
2 | QLQ | 25.5 | 4.1e-10 | 65 | 97 | 3 | 35 |
QLQ 3 FTaaQlqlLksQilAyKyLaanqPvPpeLlqai 35 FT Qlq+L Q l+yKy+ + PvP +L+++i SapurV1A.0260s0250.1.p 65 FTILQLQELQLQSLIYKYIQVKSPVPYHLVLPI 97 7888****************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51666 | 15.9 | 64 | 99 | IPR014978 | Glutamine-Leucine-Glutamine, QLQ |
Pfam | PF08880 | 6.1E-8 | 65 | 97 | IPR014978 | Glutamine-Leucine-Glutamine, QLQ |
PROSITE profile | PS51667 | 20.392 | 136 | 168 | IPR014977 | WRC domain |
Pfam | PF08879 | 3.9E-15 | 137 | 168 | IPR014977 | WRC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0005524 | Molecular Function | ATP binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 169 aa Download sequence Send to blast |
MEPQAPPSRI ARLSNSRTGL RDGWNMEGNR RNGRSRSPPI GLGAELGLGG SSQRSRTGCK 60 ITYGFTILQL QELQLQSLIY KYIQVKSPVP YHLVLPILKS VATSLGALSS GLYQLYPSLM 120 GSKCNPLHLE YKNRTEPEPG RCRRTDGKKW RCSKEVLPCQ KYCDKHIH* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Involved in the regulation of cell proliferation in developing shoots and leaves (PubMed:24854713). Does not possess transactivation activity (PubMed:24854713). {ECO:0000269|PubMed:24854713}. | |||||
UniProt | Transcription activator that plays a regulatory role in gibberellin-induced stem elongation. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | SapurV1A.0260s0250.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002298083.2 | 2e-94 | growth-regulating factor 10 | ||||
Swissprot | A5HEG9 | 4e-32 | GRF10_MAIZE; GRF-interacting factor 10 | ||||
Swissprot | Q6AWX7 | 2e-32 | GRF12_ORYSJ; Growth-regulating factor 12 | ||||
TrEMBL | B9GKS4 | 5e-93 | B9GKS4_POPTR; Uncharacterized protein | ||||
STRING | POPTR_0001s08310.1 | 8e-94 | (Populus trichocarpa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF14195 | 10 | 17 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G13960.1 | 3e-19 | growth-regulating factor 5 |
Link Out ? help Back to Top | |
---|---|
Phytozome | SapurV1A.0260s0250.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|