PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | SMil_00007978-RA_Salv | ||||||||
Common Name | WRKY17 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 164aa MW: 18847.1 Da PI: 9.7779 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 104.6 | 5.2e-33 | 85 | 143 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYGqK vk+++fprsYYrCt++gC+vkk+v+r ++d+ +v++tYeg H h+ SMil_00007978-RA_Salv 85 LDDGYRWRKYGQKAVKNNTFPRSYYRCTHQGCNVKKQVQRLSKDEGIVVTTYEGVHSHP 143 59********************************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 8.7E-35 | 70 | 143 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 6.8E-30 | 77 | 144 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 30.01 | 80 | 145 | IPR003657 | WRKY domain |
SMART | SM00774 | 1.2E-38 | 85 | 144 | IPR003657 | WRKY domain |
Pfam | PF03106 | 1.1E-26 | 86 | 143 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 164 aa Download sequence Send to blast |
MDNFAAAMSS SSSSFFNMMM TSQPHDIDHH QVLIQHNNNG FMEQNQSIPT AAEPENEAKG 60 GKKKGEKKSR KPRFAFQTRS QVDILDDGYR WRKYGQKAVK NNTFPRSYYR CTHQGCNVKK 120 QVQRLSKDEG IVVTTYEGVH SHPIQKSTDN FDHILSQMQI YTSL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 2e-28 | 75 | 142 | 7 | 74 | Probable WRKY transcription factor 4 |
2lex_A | 2e-28 | 75 | 142 | 7 | 74 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KM823140 | 0.0 | KM823140.1 Salvia miltiorrhiza WRKY protein (WRKY17) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_007226197.1 | 2e-70 | probable WRKY transcription factor 75 | ||||
Refseq | XP_009615508.1 | 2e-70 | PREDICTED: probable WRKY transcription factor 75 | ||||
Refseq | XP_016446514.1 | 2e-70 | PREDICTED: probable WRKY transcription factor 75 | ||||
Swissprot | Q9FYA2 | 1e-55 | WRK75_ARATH; Probable WRKY transcription factor 75 | ||||
TrEMBL | A0A0D5YAD3 | 1e-116 | A0A0D5YAD3_SALMI; WRKY protein | ||||
STRING | EMJ27396 | 7e-70 | (Prunus persica) | ||||
STRING | XP_009615508.1 | 6e-70 | (Nicotiana tomentosiformis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA2204 | 24 | 61 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G13080.1 | 4e-57 | WRKY DNA-binding protein 75 |