PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Rsa1.0_70461.1_g00001.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 108aa MW: 11995.4 Da PI: 7.2534 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 86.2 | 3e-27 | 58 | 108 | 1 | 52 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEE CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitY 52 ++DgynWrKYGqK vkg+ef rsYYrCt+++C++kk++ers +++v+++Y Rsa1.0_70461.1_g00001.1 58 MEDGYNWRKYGQKLVKGNEFVRSYYRCTHPNCKAKKQLERSP-GGQIVDTVY 108 58****************************************.9*****999 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50811 | 19.118 | 53 | 98 | IPR003657 | WRKY domain |
Gene3D | G3DSA:2.20.25.80 | 5.1E-23 | 54 | 108 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 1.7E-21 | 54 | 107 | IPR003657 | WRKY domain |
SMART | SM00774 | 5.2E-25 | 58 | 108 | IPR003657 | WRKY domain |
Pfam | PF03106 | 1.4E-20 | 59 | 108 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 108 aa Download sequence Send to blast |
EIPESTDSKK LVPASVSEEE EVVVASEKPP KAPESGTVLS LQSGSEGSSS PFIREKVMED 60 GYNWRKYGQK LVKGNEFVRS YYRCTHPNCK AKKQLERSPG GQIVDTVY |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 3e-15 | 44 | 98 | 1 | 57 | Probable WRKY transcription factor 4 |
2lex_A | 3e-15 | 44 | 98 | 1 | 57 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Binds to a 5'-CGTTGACCGAG-3' consensus core sequence which contains a W box, a frequently occurring elicitor-responsive cis-acting element. {ECO:0000269|PubMed:8972846}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Rsa1.0_70461.1_g00001.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By salicylic acid (SA). {ECO:0000269|PubMed:17264121}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC189641 | 1e-109 | AC189641.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrS008C11, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018491223.1 | 2e-71 | PREDICTED: WRKY transcription factor 1 | ||||
Swissprot | Q9SI37 | 2e-50 | WRKY1_ARATH; WRKY transcription factor 1 | ||||
TrEMBL | A0A398A3Y4 | 3e-62 | A0A398A3Y4_BRACM; Uncharacterized protein | ||||
STRING | Bra013187.1-P | 3e-62 | (Brassica rapa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM7949 | 26 | 39 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G04880.2 | 6e-38 | zinc-dependent activator protein-1 |
Publications ? help Back to Top | |||
---|---|---|---|
|