PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Potri.010G240800.1 | ||||||||
Common Name | POPTR_0010s24710g | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 236aa MW: 26522.4 Da PI: 6.9625 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 29 | 2.5e-09 | 23 | 65 | 3 | 44 |
SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrw 44 rWT eEd+++ +a + ++ + +W +Ia+++ +++ ++k+++ Potri.010G240800.1 23 RWTREEDKIFEQALTIFPENlpdRWQSIANHIR--KSAWEVKEHY 65 9*******************************8..89999**998 PP | |||||||
2 | Myb_DNA-binding | 43.9 | 5.3e-14 | 131 | 175 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +WT++E++l++ + +++G+g+W++I+r + +Rt+ q+ s+ qky Potri.010G240800.1 131 PWTEDEHKLFLVGLNKFGKGDWRSISRNVVITRTPTQVASHAQKY 175 8*****************************99************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00717 | 4.4E-8 | 20 | 71 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.3E-4 | 22 | 68 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 1.04E-12 | 23 | 77 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 4.3E-6 | 23 | 65 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 3.11E-8 | 23 | 65 | No hit | No description |
PROSITE profile | PS50090 | 6.702 | 23 | 69 | IPR017877 | Myb-like domain |
PROSITE profile | PS51294 | 17.998 | 124 | 180 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 6.14E-17 | 125 | 181 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 6.4E-17 | 127 | 179 | IPR006447 | Myb domain, plants |
Gene3D | G3DSA:1.10.10.60 | 1.9E-10 | 128 | 174 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.7E-11 | 128 | 178 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 5.33E-10 | 131 | 176 | No hit | No description |
Pfam | PF00249 | 8.1E-13 | 131 | 175 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 236 aa Download sequence Send to blast |
MHQDFNFQTR CLTQPPHATA ATRWTREEDK IFEQALTIFP ENLPDRWQSI ANHIRKSAWE 60 VKEHYDILVH DVLAIDSGRV ELPTYRDDES VSWESSGGDD GGMVAAGAPP SGQICFGGKG 120 KQDTERKKGT PWTEDEHKLF LVGLNKFGKG DWRSISRNVV ITRTPTQVAS HAQKYFLRQN 180 SVKKERKRSS IHDITSVDNN TVGPSADDYW NSPPGPPANQ DGPPGLGYQN FRFQM* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
2cjj_A | 3e-13 | 24 | 86 | 11 | 74 | RADIALIS |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in young seedlings, developing leaves, sepals and trichomes. {ECO:0000269|PubMed:26243618}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that coordinates abscisic acid (ABA) biosynthesis and signaling-related genes via binding to the specific promoter motif 5'-(A/T)AACCAT-3'. Represses ABA-mediated salt (e.g. NaCl and KCl) stress tolerance. Regulates leaf shape and promotes vegetative growth. {ECO:0000269|PubMed:26243618}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00055 | PBM | Transfer from AT5G04760 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Potri.010G240800.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by salicylic acid (SA) and gibberellic acid (GA) (PubMed:16463103). Triggered by dehydration and salt stress (PubMed:26243618). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:26243618}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002316492.2 | 1e-178 | transcription factor SRM1 | ||||
Swissprot | Q9FNN6 | 3e-58 | SRM1_ARATH; Transcription factor SRM1 | ||||
TrEMBL | B9HVV5 | 1e-176 | B9HVV5_POPTR; MYB family protein | ||||
STRING | POPTR_0010s24710.1 | 1e-177 | (Populus trichocarpa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF6068 | 32 | 51 | Representative plant | OGRP275 | 17 | 122 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G04760.1 | 2e-78 | MYB family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Potri.010G240800.1 |
Entrez Gene | 7469525 |
Publications ? help Back to Top | |||
---|---|---|---|
|