PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Phvul.002G100500.1 | ||||||||
Common Name | PHAVU_002G100500g | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 113aa MW: 12616.8 Da PI: 9.1652 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 73.4 | 4.4e-23 | 58 | 104 | 1 | 47 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllk 47 +CaaCk+lrr+Ca+dCv+apyfpa++p+kfanvh++FGasn+ k+l+ Phvul.002G100500.1 58 PCAACKLLRRRCAQDCVFAPYFPADEPHKFANVHRVFGASNINKMLQ 104 7********************************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 17.125 | 57 | 112 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 3.6E-22 | 58 | 104 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 113 aa Download sequence Send to blast |
MQASSIPSLS LLPFTFLHFI FSYKSFSFLL CHSHVLIELH NNKGNMKDGG RKQGAPSPCA 60 ACKLLRRRCA QDCVFAPYFP ADEPHKFANV HRVFGASNIN KMLQVHSLCC LY* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 7e-21 | 54 | 103 | 7 | 56 | LOB family transfactor Ramosa2.1 |
5ly0_B | 7e-21 | 54 | 103 | 7 | 56 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Phvul.002G100500.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP015034 | 1e-100 | AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_007157815.1 | 2e-78 | hypothetical protein PHAVU_002G100500g | ||||
Swissprot | Q9SHE9 | 4e-33 | LBD4_ARATH; LOB domain-containing protein 4 | ||||
TrEMBL | V7CI67 | 4e-77 | V7CI67_PHAVU; Uncharacterized protein | ||||
STRING | XP_007157815.1 | 7e-78 | (Phaseolus vulgaris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1334 | 34 | 105 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G31320.1 | 2e-35 | LOB domain-containing protein 4 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Phvul.002G100500.1 |
Entrez Gene | 18637509 |