PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Peaxi162Scf00772g00049.1

Organism

Petunia axillaris

Taxonomic ID

33119

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia

Family

bHLH

Protein Properties

Length: 82aa MW: 9603.32 Da PI: 11.055

Description

bHLH family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Peaxi162Scf00772g00049.1	genome	SGN	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	HLH	34.5	3.6e-11	3	55	1	54
CHHHHHHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS HLH 1 rrrahnerErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54 ++ +hn Er RR+++N ++ r+llP+a +++kKls +++ + eYI +L Peaxi162Scf00772g00049.1 3 KKLKHNTSERSRRKKMNFLYSSPRTLLPSA-TQKKKKLSFPATVSFVQEYIPEL 55 6789***********************7.477777************988 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50888	12.011	2	55	IPR011598	Myc-type, basic helix-loop-helix (bHLH) domain
Gene3D	G3DSA:4.10.280.10	5.5E-9	3	66	IPR011598	Myc-type, basic helix-loop-helix (bHLH) domain
CDD	cd00083	2.91E-5	3	60	No hit	No description
Pfam	PF00010	2.4E-8	3	55	IPR011598	Myc-type, basic helix-loop-helix (bHLH) domain
SuperFamily	SSF47459	1.01E-10	3	69	IPR011598	Myc-type, basic helix-loop-helix (bHLH) domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 82 aa Download sequence Send to blast
MAKKLKHNTS ERSRRKKMNF LYSSPRTLLP SATQKKKKLS FPATVSFVQE YIPELKKEIE 60 RLSQTKKFAF IDCVKERISN PA

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Up regulated by iron deficiency in roots and leaves, as well as by nickel, high zinc or high copper treatments. Repressed by high iron, low copper and low zinc treatments. {ECO:0000269\|PubMed:17516080}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_009600422.1	5e-31	PREDICTED: transcription factor ORG2-like
Swissprot	Q9FYE6	1e-16	BH101_ARATH; Transcription factor bHLH101
TrEMBL	A0A1S3YVA5	2e-28	A0A1S3YVA5_TOBAC; transcription factor ORG2-like
TrEMBL	A0A1S4DCF5	5e-28	A0A1S4DCF5_TOBAC; transcription factor bHLH101-like
STRING	XP_009600422.1	2e-30	(Nicotiana tomentosiformis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA2226	22	56

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G04150.1	4e-19	bHLH family protein

Publications ? help Back to Top
Maurer F,Naranjo Arcos MA,Bauer P Responses of a triple mutant defective in three iron deficiency-induced Basic Helix-Loop-Helix genes of the subgroup Ib(2) to iron deficiency and salicylic acid. PLoS ONE, 2014. 9(6): p. e99234 [PMID:24919188] Martínez-Trujillo M, et al. Chromate alters root system architecture and activates expression of genes involved in iron homeostasis and signaling in Arabidopsis thaliana. Plant Mol. Biol., 2014. 86(1-2): p. 35-50 [PMID:24928490] Li X,Zhang H,Ai Q,Liang G,Yu D Two bHLH Transcription Factors, bHLH34 and bHLH104, Regulate Iron Homeostasis in Arabidopsis thaliana. Plant Physiol., 2016. 170(4): p. 2478-93 [PMID:26921305] Van Dingenen J, et al. Strobilurins as growth-promoting compounds: how Stroby regulates Arabidopsis leaf growth. Plant Cell Environ., 2017. 40(9): p. 1748-1760 [PMID:28444690] Ezer D, et al. The G-Box Transcriptional Regulatory Code in Arabidopsis. Plant Physiol., 2017. 175(2): p. 628-640 [PMID:28864470] Kailasam S,Wang Y,Lo JC,Chang HF,Yeh KC S-Nitrosoglutathione works downstream of nitric oxide to mediate iron-deficiency signaling in Arabidopsis. Plant J., 2018. 94(1): p. 157-168 [PMID:29396986] Kurt F,Filiz E Genome-wide and comparative analysis of bHLH38, bHLH39, bHLH100 and bHLH101 genes in Arabidopsis, tomato, rice, soybean and maize: insights into iron (Fe) homeostasis. Biometals, 2018. 31(4): p. 489-504 [PMID:29546482]