PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Peaxi162Scf00646g00012.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
|
||||||||
Family | GRAS | ||||||||
Protein Properties | Length: 94aa MW: 10823.4 Da PI: 4.244 | ||||||||
Description | GRAS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GRAS | 105.4 | 7.8e-33 | 2 | 93 | 84 | 179 |
GRAS 84 fsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakf 168 f+e +P+lk++++++Nq I ea+e+e++vHi+D+++ ++lQW aLl+ L++ pegp++lRiTg ++ +ke l ++++ L++ Peaxi162Scf00646g00012.1 2 FFEFFPFLKVAFMVTNQVIIEAMEEEKMVHIVDLNAAEPLQWQALLHDLSAHPEGPAHLRITGAHQ----QKEVLDQMAQVLTEE 82 9*****************************************************************....9************** PP GRAS 169 Aeelgvpfefn 179 A++l+ pf+fn Peaxi162Scf00646g00012.1 83 AANLDFPFQFN 93 **********8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50985 | 21.491 | 1 | 94 | IPR005202 | Transcription factor GRAS |
Pfam | PF03514 | 2.7E-30 | 2 | 93 | IPR005202 | Transcription factor GRAS |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 94 aa Download sequence Send to blast |
MFFEFFPFLK VAFMVTNQVI IEAMEEEKMV HIVDLNAAEP LQWQALLHDL SAHPEGPAHL 60 RITGAHQQKE VLDQMAQVLT EEAANLDFPF QFNE |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5b3g_A | 2e-16 | 1 | 92 | 101 | 192 | Protein SCARECROW |
5b3h_A | 2e-16 | 1 | 92 | 100 | 191 | Protein SCARECROW |
5b3h_D | 2e-16 | 1 | 92 | 100 | 191 | Protein SCARECROW |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in plant development. {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HG975451 | 6e-88 | HG975451.1 Solanum pennellii chromosome ch12, complete genome. | |||
GenBank | HG975524 | 6e-88 | HG975524.1 Solanum lycopersicum chromosome ch12, complete genome. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016447393.1 | 2e-49 | PREDICTED: scarecrow-like protein 3 | ||||
Refseq | XP_019236517.1 | 2e-49 | PREDICTED: scarecrow-like protein 3 | ||||
Swissprot | Q9LPR8 | 8e-38 | SCL3_ARATH; Scarecrow-like protein 3 | ||||
TrEMBL | A0A0V0IME1 | 2e-48 | A0A0V0IME1_SOLCH; Putative ovule protein (Fragment) | ||||
TrEMBL | A0A1J6JZ68 | 5e-48 | A0A1J6JZ68_NICAT; Scarecrow-like protein 3 | ||||
TrEMBL | A0A1S3Y561 | 4e-48 | A0A1S3Y561_TOBAC; scarecrow-like protein 3 | ||||
STRING | XP_009761009.1 | 2e-48 | (Nicotiana sylvestris) | ||||
STRING | PGSC0003DMT400011839 | 2e-48 | (Solanum tuberosum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA16041 | 3 | 6 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G50420.1 | 4e-40 | scarecrow-like 3 |
Publications ? help Back to Top | |||
---|---|---|---|
|