PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Peaxi162Scf00208g00014.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 177aa MW: 19355 Da PI: 5.7301 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 171 | 1.3e-53 | 24 | 116 | 1 | 93 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkv 85 +reqdr+lPian++rimkk lP+n+ki+kd+k+tvqecvsefisf+tseasdkcqrekrktingddll+alatlGfedy+eplk+ Peaxi162Scf00208g00014.1 24 MREQDRYLPIANIGRIMKKGLPSNGKIAKDSKDTVQECVSEFISFITSEASDKCQREKRKTINGDDLLHALATLGFEDYIEPLKI 108 59*********************************************************************************** PP NF-YB 86 ylkkyrel 93 yl++yre+ Peaxi162Scf00208g00014.1 109 YLTRYREV 116 ******98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 3.0E-49 | 21 | 116 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 4.04E-37 | 27 | 117 | IPR009072 | Histone-fold |
Pfam | PF00808 | 1.3E-26 | 30 | 94 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 4.6E-20 | 58 | 76 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 61 | 77 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 4.6E-20 | 77 | 95 | No hit | No description |
PRINTS | PR00615 | 4.6E-20 | 96 | 114 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 177 aa Download sequence Send to blast |
MAEAASPGGG GGHEESGGSP QCSMREQDRY LPIANIGRIM KKGLPSNGKI AKDSKDTVQE 60 CVSEFISFIT SEASDKCQRE KRKTINGDDL LHALATLGFE DYIEPLKIYL TRYREVIMIQ 120 LHVFNVMVLR LGDAKGSAMV GDASVRKDIV GNQLGPNMQF VYEGSFAQGL DYGNSQM |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 3e-47 | 24 | 115 | 1 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 3e-47 | 24 | 115 | 1 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009604648.1 | 1e-88 | PREDICTED: nuclear transcription factor Y subunit B-10-like | ||||
Refseq | XP_009782060.1 | 1e-88 | PREDICTED: nuclear transcription factor Y subunit B-10-like | ||||
Refseq | XP_016476361.1 | 1e-88 | PREDICTED: nuclear transcription factor Y subunit B-10-like | ||||
Refseq | XP_018627362.1 | 1e-88 | PREDICTED: nuclear transcription factor Y subunit B-10-like | ||||
Refseq | XP_019264327.1 | 1e-88 | PREDICTED: nuclear transcription factor Y subunit B-10-like | ||||
Swissprot | Q8VYK4 | 1e-65 | NFYB8_ARATH; Nuclear transcription factor Y subunit B-8 | ||||
TrEMBL | A0A1S4AI78 | 3e-87 | A0A1S4AI78_TOBAC; nuclear transcription factor Y subunit B-10-like | ||||
TrEMBL | A0A1U7X6G3 | 3e-87 | A0A1U7X6G3_NICSY; nuclear transcription factor Y subunit B-10-like | ||||
TrEMBL | A0A314L5Z4 | 3e-87 | A0A314L5Z4_NICAT; Nuclear transcription factor y subunit b-10 | ||||
STRING | XP_009782060.1 | 4e-88 | (Nicotiana sylvestris) | ||||
STRING | XP_009604648.1 | 5e-88 | (Nicotiana tomentosiformis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA111 | 24 | 356 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G53340.1 | 3e-65 | nuclear factor Y, subunit B10 |
Publications ? help Back to Top | |||
---|---|---|---|
|