PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Peaxi162Scf00102g00931.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
|
||||||||
Family | HD-ZIP | ||||||||
Protein Properties | Length: 246aa MW: 28007.5 Da PI: 6.1028 | ||||||||
Description | HD-ZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 61.6 | 1.2e-19 | 128 | 182 | 2 | 56 |
T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS Homeobox 2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 rk+ ++tk+q +Lee F+++++++ ++++ LAk+lgL rqV vWFqNrRa+ k Peaxi162Scf00102g00931.1 128 RKKLRLTKDQSAVLEESFKEHNTLNPKQKQALAKRLGLRPRQVEVWFQNRRARTK 182 78889************************************************98 PP | |||||||
2 | HD-ZIP_I/II | 129.5 | 1.3e-41 | 128 | 217 | 1 | 91 |
HD-ZIP_I/II 1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeve 85 +kk+rl+k+q+++LEesF+e+++L+p++K++la++Lgl+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+kev+ Peaxi162Scf00102g00931.1 128 RKKLRLTKDQSAVLEESFKEHNTLNPKQKQALAKRLGLRPRQVEVWFQNRRARTKLKQTEVDCEFLKRCCENLTEENRRLQKEVQ 212 69*********************************************************************************** PP HD-ZIP_I/II 86 eLreel 91 eLr +l Peaxi162Scf00102g00931.1 213 ELR-AL 217 **9.55 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF04618 | 1.3E-29 | 1 | 105 | IPR006712 | HD-ZIP protein, N-terminal |
Gene3D | G3DSA:1.10.10.60 | 1.3E-18 | 119 | 178 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 6.68E-19 | 120 | 185 | IPR009057 | Homeodomain-like |
PROSITE profile | PS50071 | 17.702 | 124 | 184 | IPR001356 | Homeobox domain |
SMART | SM00389 | 5.4E-17 | 126 | 188 | IPR001356 | Homeobox domain |
CDD | cd00086 | 1.02E-15 | 128 | 185 | No hit | No description |
Pfam | PF00046 | 4.5E-17 | 128 | 182 | IPR001356 | Homeobox domain |
PRINTS | PR00031 | 1.1E-5 | 155 | 164 | IPR000047 | Helix-turn-helix motif |
PROSITE pattern | PS00027 | 0 | 159 | 182 | IPR017970 | Homeobox, conserved site |
PRINTS | PR00031 | 1.1E-5 | 164 | 180 | IPR000047 | Helix-turn-helix motif |
Pfam | PF02183 | 1.7E-11 | 184 | 218 | IPR003106 | Leucine zipper, homeobox-associated |
SMART | SM00340 | 4.2E-27 | 184 | 227 | IPR003106 | Leucine zipper, homeobox-associated |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0008283 | Biological Process | cell proliferation | ||||
GO:0009641 | Biological Process | shade avoidance | ||||
GO:0009733 | Biological Process | response to auxin | ||||
GO:0009735 | Biological Process | response to cytokinin | ||||
GO:0009826 | Biological Process | unidimensional cell growth | ||||
GO:0010016 | Biological Process | shoot system morphogenesis | ||||
GO:0010017 | Biological Process | red or far-red light signaling pathway | ||||
GO:0010218 | Biological Process | response to far red light | ||||
GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
GO:0048364 | Biological Process | root development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0042803 | Molecular Function | protein homodimerization activity | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 246 aa Download sequence Send to blast |
MENQDLGLSL SLSFPENRTT ANNPLQLNLM PSLASSTSPF NLFQKTSWTD SFPSSDRNLE 60 TCRTFLKGID VNRVPTTTDV EEEAGVSSPN STISSLSGNK RSEREANCEE LDMDTRGISD 120 EEDGETSRKK LRLTKDQSAV LEESFKEHNT LNPKQKQALA KRLGLRPRQV EVWFQNRRAR 180 TKLKQTEVDC EFLKRCCENL TEENRRLQKE VQELRALKLS PQFYMQMTPP TTLTMCPSCE 240 RVAAPP |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 126 | 132 | SRKKLRL |
2 | 176 | 184 | RRARTKLKQ |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in the negative regulation of cell elongation and specific cell proliferation processes such as lateral root formation and secondary growth of the vascular system. Acts as mediator of the red/far-red light effects on leaf cell expansion in the shading response. Binds to the DNA sequence 5'-CAAT[GC]ATTG-3'. Negatively regulates its own expression. {ECO:0000269|PubMed:10477292, ECO:0000269|PubMed:11260495, ECO:0000269|PubMed:8449400}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Rapidly and strongly induced by lowering the ratio of red to far-red light. {ECO:0000269|PubMed:8106086}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_019230533.1 | 1e-150 | PREDICTED: homeobox-leucine zipper protein HAT4-like | ||||
Swissprot | Q05466 | 1e-103 | HAT4_ARATH; Homeobox-leucine zipper protein HAT4 | ||||
TrEMBL | A0A314KKW1 | 1e-149 | A0A314KKW1_NICAT; Homeobox-leucine zipper protein hat4 | ||||
STRING | XP_009590186.1 | 1e-146 | (Nicotiana tomentosiformis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA1118 | 24 | 85 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G16780.1 | 1e-106 | homeobox protein 2 |