PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Pavir.J349300.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
|
||||||||
Family | Dof | ||||||||
Protein Properties | Length: 126aa MW: 12873.5 Da PI: 9.8414 | ||||||||
Description | Dof family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | zf-Dof | 63.6 | 3.6e-20 | 4 | 36 | 28 | 60 |
zf-Dof 28 qPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 Pr+fC+aC+ryWt+GGa+rnvPvG+grrkn+ Pavir.J349300.1.p 4 NPRHFCRACHRYWTAGGAIRNVPVGSGRRKNRP 36 6*****************************985 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50884 | 16.6 | 1 | 36 | IPR003851 | Zinc finger, Dof-type |
Pfam | PF02701 | 2.5E-15 | 3 | 35 | IPR003851 | Zinc finger, Dof-type |
ProDom | PD007478 | 3.0E-11 | 3 | 35 | IPR003851 | Zinc finger, Dof-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 126 aa Download sequence Send to blast |
MGDNPRHFCR ACHRYWTAGG AIRNVPVGSG RRKNRPVPLP PPPAPAPHAG DATGTPTSAD 60 HVSESGSPPV FTTASVGLAV PYRGSPFHLA PSPACTAAGL PETAGQYWWL VAGGAARAVA 120 PDRAF* |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Pavir.J349300.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | EU955011 | 2e-48 | EU955011.1 Zea mays clone 1501573 hypothetical protein mRNA, complete cds. | |||
GenBank | KJ726995 | 2e-48 | KJ726995.1 Zea mays clone pUT3967 C2C2-DOF transcription factor (DOF10) gene, partial cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_025809286.1 | 6e-58 | dof zinc finger protein 5-like | ||||
TrEMBL | A0A3L6RC51 | 7e-57 | A0A3L6RC51_PANMI; Dof zinc finger protein DOF5.1-like | ||||
STRING | Pavir.J38170.1.p | 6e-80 | (Panicum virgatum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP6495 | 28 | 51 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G34140.1 | 4e-15 | Dof family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Pavir.J349300.1.p |