PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PK22221.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 74aa MW: 8871.11 Da PI: 11.2278 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 101.6 | 1.1e-31 | 3 | 74 | 55 | 127 |
NAM 55 ekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyr 127 ++ewyfFs++d+ky+tg+r+nrat++g+Wkatg+dk + + +++g++ktLvfy+grap+g+k+dW+mheyr PK22221.1 3 QSEWYFFSHKDRKYPTGSRTNRATNAGFWKATGRDKCIRN-AFKKIGMRKTLVFYRGRAPHGQKSDWIMHEYR 74 579************************************9.8899***************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51005 | 34.846 | 1 | 74 | IPR003441 | NAC domain |
SuperFamily | SSF101941 | 2.62E-30 | 3 | 74 | IPR003441 | NAC domain |
Pfam | PF02365 | 5.5E-16 | 6 | 74 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 74 aa Download sequence Send to blast |
TPQSEWYFFS HKDRKYPTGS RTNRATNAGF WKATGRDKCI RNAFKKIGMR KTLVFYRGRA 60 PHGQKSDWIM HEYR |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3swm_A | 5e-28 | 3 | 74 | 73 | 144 | NAC domain-containing protein 19 |
3swm_B | 5e-28 | 3 | 74 | 73 | 144 | NAC domain-containing protein 19 |
3swm_C | 5e-28 | 3 | 74 | 73 | 144 | NAC domain-containing protein 19 |
3swm_D | 5e-28 | 3 | 74 | 73 | 144 | NAC domain-containing protein 19 |
3swp_A | 5e-28 | 3 | 74 | 73 | 144 | NAC domain-containing protein 19 |
3swp_B | 5e-28 | 3 | 74 | 73 | 144 | NAC domain-containing protein 19 |
3swp_C | 5e-28 | 3 | 74 | 73 | 144 | NAC domain-containing protein 19 |
3swp_D | 5e-28 | 3 | 74 | 73 | 144 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator. Together with BRN1 and SMB, regulates cellular maturation of root cap. Promotes the expression of genes involved in secondary cell walls (SCW) biosynthesis. {ECO:0000269|PubMed:20197506}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009757635.1 | 1e-48 | PREDICTED: protein BEARSKIN1 | ||||
Refseq | XP_016556495.1 | 1e-47 | PREDICTED: protein BEARSKIN2 | ||||
Swissprot | Q9SV87 | 2e-46 | BRN2_ARATH; Protein BEARSKIN2 | ||||
TrEMBL | A0A067E845 | 2e-46 | A0A067E845_CITSI; Uncharacterized protein (Fragment) | ||||
TrEMBL | A0A1U7V7B1 | 3e-47 | A0A1U7V7B1_NICSY; protein BEARSKIN1 | ||||
TrEMBL | A0A1U8FL53 | 2e-46 | A0A1U8FL53_CAPAN; protein BEARSKIN2 | ||||
TrEMBL | A0A2G3AIX3 | 2e-46 | A0A2G3AIX3_CAPAN; Protein BEARSKIN2 | ||||
TrEMBL | A0A2G3DGI5 | 2e-46 | A0A2G3DGI5_CAPCH; Protein BEARSKIN2 | ||||
TrEMBL | A0A438CA78 | 2e-46 | A0A438CA78_VITVI; Protein BEARSKIN2 | ||||
STRING | Lus10013782 | 1e-46 | (Linum usitatissimum) | ||||
STRING | Solyc06g063430.1.1 | 5e-47 | (Solanum lycopersicum) | ||||
STRING | XP_009757635.1 | 5e-48 | (Nicotiana sylvestris) | ||||
STRING | XP_009761820.1 | 4e-47 | (Nicotiana sylvestris) | ||||
STRING | XP_009602081.1 | 8e-47 | (Nicotiana tomentosiformis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF8752 | 33 | 43 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G10350.1 | 6e-49 | NAC domain containing protein 70 |
Publications ? help Back to Top | |||
---|---|---|---|
|