PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PK20005.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
|
||||||||
Family | NF-YA | ||||||||
Protein Properties | Length: 151aa MW: 16930.7 Da PI: 10.4398 | ||||||||
Description | NF-YA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | CBFB_NFYA | 102.2 | 4.9e-32 | 76 | 131 | 2 | 58 |
CBFB_NFYA 2 eplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 p+YVNaKQy++Il+RRq+Rak+e+++kl +++rkpylheSRh hAl+R RgsgGrF PK20005.1 76 GPIYVNAKQYHGILRRRQSRAKQEAQNKL-IRNRKPYLHESRHLHALNRVRGSGGRF 131 69***************************.**************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00521 | 9.6E-35 | 73 | 134 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE profile | PS51152 | 35.25 | 74 | 134 | IPR001289 | Nuclear transcription factor Y subunit A |
Pfam | PF02045 | 1.5E-27 | 77 | 131 | IPR001289 | Nuclear transcription factor Y subunit A |
PRINTS | PR00616 | 8.0E-24 | 77 | 99 | IPR001289 | Nuclear transcription factor Y subunit A |
PRINTS | PR00616 | 8.0E-24 | 108 | 131 | IPR001289 | Nuclear transcription factor Y subunit A |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 151 aa Download sequence Send to blast |
XSEGAEDQMK PAFFLSKPDF MLHHSQLGGS HSLASVQYPY ADPYYGGFLT SYGPQALMVG 60 LQSTRVPLPL DLTDNGPIYV NAKQYHGILR RRQSRAKQEA QNKLIRNRKP YLHESRHLHA 120 LNRVRGSGGR FLSKKQLQHQ SSDSNSSSSS S |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4awl_A | 6e-21 | 77 | 136 | 4 | 63 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_024017193.1 | 3e-81 | nuclear transcription factor Y subunit A-7 isoform X1 | ||||
Refseq | XP_024017194.1 | 3e-81 | nuclear transcription factor Y subunit A-7 isoform X1 | ||||
Refseq | XP_024017195.1 | 2e-81 | nuclear transcription factor Y subunit A-7 isoform X2 | ||||
Swissprot | Q9LNP6 | 2e-43 | NFYA8_ARATH; Nuclear transcription factor Y subunit A-8 | ||||
TrEMBL | A0A2P5BH09 | 1e-84 | A0A2P5BH09_TREOI; Nuclear transcription factor Y subunit A | ||||
STRING | XP_010090113.1 | 3e-69 | (Morus notabilis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF6949 | 31 | 49 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G17590.4 | 6e-45 | nuclear factor Y, subunit A8 |
Publications ? help Back to Top | |||
---|---|---|---|
|