PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PK15571.2 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
|
||||||||
Family | HD-ZIP | ||||||||
Protein Properties | Length: 69aa MW: 8183.59 Da PI: 11.3742 | ||||||||
Description | HD-ZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 40.6 | 4.2e-13 | 3 | 29 | 30 | 56 |
HHHHHHHCTS-HHHHHHHHHHHHHHHH CS Homeobox 30 reeLAkklgLterqVkvWFqNrRakek 56 + +LA++lgL+ rqV +WFqN+Ra++k PK15571.2 3 KLQLASELGLQPRQVAIWFQNKRARWK 29 679***********************9 PP | |||||||
2 | HD-ZIP_I/II | 86.2 | 4.4e-28 | 1 | 66 | 27 | 92 |
HD-ZIP_I/II 27 erKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 ++K +la+eLglqprqva+WFqn+RAR+k+kqlE+dy+ L ++y++l+++ ++L+ke++ L+ +++ PK15571.2 1 KKKLQLASELGLQPRQVAIWFQNKRARWKSKQLERDYSILLANYKNLASRFDALKKEKQGLALQVR 66 68***********************************************************98876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
CDD | cd00086 | 8.33E-7 | 1 | 32 | No hit | No description |
PROSITE profile | PS50071 | 13.394 | 1 | 31 | IPR001356 | Homeobox domain |
Pfam | PF00046 | 1.5E-10 | 2 | 29 | IPR001356 | Homeobox domain |
SuperFamily | SSF46689 | 4.71E-12 | 2 | 41 | IPR009057 | Homeodomain-like |
PRINTS | PR00031 | 2.1E-6 | 2 | 11 | IPR000047 | Helix-turn-helix motif |
Gene3D | G3DSA:1.10.10.60 | 1.4E-13 | 3 | 38 | IPR009057 | Homeodomain-like |
PROSITE pattern | PS00027 | 0 | 6 | 29 | IPR017970 | Homeobox, conserved site |
PRINTS | PR00031 | 2.1E-6 | 11 | 27 | IPR000047 | Helix-turn-helix motif |
Pfam | PF02183 | 1.2E-13 | 31 | 66 | IPR003106 | Leucine zipper, homeobox-associated |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 69 aa Download sequence Send to blast |
KKKLQLASEL GLQPRQVAIW FQNKRARWKS KQLERDYSIL LANYKNLASR FDALKKEKQG 60 LALQVRKNQ |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription activator that may act as growth regulators in response to water deficit. {ECO:0000269|PubMed:15604708, ECO:0000269|PubMed:8771791}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By water deficit, by abscisic acid (ABA) and by salt stress. {ECO:0000269|PubMed:16055682, ECO:0000269|PubMed:8771791}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_024024137.1 | 1e-32 | homeobox-leucine zipper protein ATHB-12 | ||||
Swissprot | P46897 | 6e-27 | ATHB7_ARATH; Homeobox-leucine zipper protein ATHB-7 | ||||
TrEMBL | A0A2P5FIG7 | 9e-32 | A0A2P5FIG7_TREOI; Octamer-binding transcription factor | ||||
TrEMBL | W9RLG5 | 7e-32 | W9RLG5_9ROSA; Homeobox-leucine zipper protein ATHB-12 | ||||
STRING | XP_010100685.1 | 1e-32 | (Morus notabilis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF5635 | 34 | 52 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G46680.1 | 2e-29 | homeobox 7 |
Publications ? help Back to Top | |||
---|---|---|---|
|