PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PK09793.2 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
|
||||||||
Family | GRF | ||||||||
Protein Properties | Length: 95aa MW: 11022.6 Da PI: 10.3266 | ||||||||
Description | GRF family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRC | 31.2 | 3.8e-10 | 78 | 94 | 1 | 17 |
WRC 1 daepgrCrRtDGKkWRC 17 d+epgrCrRtDGKkWRC PK09793.2 78 DPEPGRCRRTDGKKWRC 94 79*************** PP | |||||||
2 | QLQ | 60.4 | 5.1e-21 | 8 | 42 | 2 | 36 |
QLQ 2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36 +FTa+Q+q+L++Q+l++Ky++++ P+Pp+Ll+ ++ PK09793.2 8 PFTASQWQELEHQALIFKYMVSGIPIPPDLLFTLK 42 8*****************************98765 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00951 | 2.7E-11 | 7 | 43 | IPR014978 | Glutamine-Leucine-Glutamine, QLQ |
Pfam | PF08880 | 3.9E-16 | 8 | 41 | IPR014978 | Glutamine-Leucine-Glutamine, QLQ |
PROSITE profile | PS51666 | 21.935 | 8 | 43 | IPR014978 | Glutamine-Leucine-Glutamine, QLQ |
PROSITE profile | PS51667 | 13.747 | 78 | 95 | IPR014977 | WRC domain |
Pfam | PF08879 | 7.6E-7 | 79 | 94 | IPR014977 | WRC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0005524 | Molecular Function | ATP binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 95 aa Download sequence Send to blast |
MSGKTRFPFT ASQWQELEHQ ALIFKYMVSG IPIPPDLLFT LKRSYLDSTA VLPSKLFPHH 60 SQHVGWNCFQ MGLGRKIDPE PGRCRRTDGK KWRCX |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that plays a role in the regulation of cell expansion in leaf and cotyledons tissues. Acts together with GIF1 for the development of appropriate leaf size and shape through the promotion and/or maintenance of cell proliferation activity in leaf primordia. {ECO:0000269|PubMed:15326298, ECO:0000269|PubMed:15960617}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_024932189.1 | 3e-57 | growth-regulating factor 5-like isoform X7 | ||||
Swissprot | Q8L8A6 | 2e-38 | GRF5_ARATH; Growth-regulating factor 5 | ||||
TrEMBL | A0A2P5BXX4 | 2e-59 | A0A2P5BXX4_PARAD; Growth-regulating factor | ||||
STRING | EMJ05977 | 3e-50 | (Prunus persica) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF4043 | 34 | 59 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G13960.1 | 7e-41 | growth-regulating factor 5 |