PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PH01000003G1900 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 168aa MW: 19255.9 Da PI: 8.7926 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 150.6 | 7.5e-47 | 25 | 153 | 2 | 128 |
NAM 2 ppGfrFhPtdeelvveyLkkkvegkk.leleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 +pGfrFhPt+eel+ +yL+ kve+ k ++++ i+ vd+y+++PwdLp ++++ ++ke++f+++rd+ky++g+r+nr+t sgyWkatg d+ v PH01000003G1900 25 MPGFRFHPTEEELIEFYLRLKVEDGKrFNIDWLIAFVDLYRFDPWDLPgAQASIGDKELFFYVPRDRKYRNGDRPNRVTPSGYWKATGADRMVR 118 79********************98875788666***************7788889*************************************** PP NAM 94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128 + +++ +glkktLvfy g+apkg +++W+m+eyrl PH01000003G1900 119 VDGNRSIGLKKTLVFYVGKAPKGLRSSWIMNEYRL 153 *********************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 2.09E-50 | 19 | 159 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 48.134 | 24 | 167 | IPR003441 | NAC domain |
Pfam | PF02365 | 2.3E-23 | 26 | 153 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 168 aa Download sequence Send to blast |
MGGADHHDTA RGGGDDVQAH DMVVMPGFRF HPTEEELIEF YLRLKVEDGK RFNIDWLIAF 60 VDLYRFDPWD LPGAQASIGD KELFFYVPRD RKYRNGDRPN RVTPSGYWKA TGADRMVRVD 120 GNRSIGLKKT LVFYVGKAPK GLRSSWIMNE YRLPHGEADR CQKRCCV* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 2e-46 | 21 | 153 | 14 | 142 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 2e-46 | 21 | 153 | 14 | 142 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 2e-46 | 21 | 153 | 14 | 142 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 2e-46 | 21 | 153 | 14 | 142 | NO APICAL MERISTEM PROTEIN |
3swm_A | 3e-46 | 21 | 153 | 17 | 145 | NAC domain-containing protein 19 |
3swm_B | 3e-46 | 21 | 153 | 17 | 145 | NAC domain-containing protein 19 |
3swm_C | 3e-46 | 21 | 153 | 17 | 145 | NAC domain-containing protein 19 |
3swm_D | 3e-46 | 21 | 153 | 17 | 145 | NAC domain-containing protein 19 |
3swp_A | 3e-46 | 21 | 153 | 17 | 145 | NAC domain-containing protein 19 |
3swp_B | 3e-46 | 21 | 153 | 17 | 145 | NAC domain-containing protein 19 |
3swp_C | 3e-46 | 21 | 153 | 17 | 145 | NAC domain-containing protein 19 |
3swp_D | 3e-46 | 21 | 153 | 17 | 145 | NAC domain-containing protein 19 |
4dul_A | 2e-46 | 21 | 153 | 14 | 142 | NAC domain-containing protein 19 |
4dul_B | 2e-46 | 21 | 153 | 14 | 142 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that acts as a floral repressor. Controls flowering time by negatively regulating CONSTANS (CO) expression in a GIGANTEA (GI)-independent manner. Regulates the plant cold response by positive regulation of the cold response genes COR15A and KIN1. May coordinate cold response and flowering time. {ECO:0000269|PubMed:17653269}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | PH01000003G1900 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Circadian regulation with a peak of expression at dawn under continuous light conditions (PubMed:17653269). Circadian regulation with a peak of expression around dusk and lowest expression around dawn under continuous light conditions (at protein level) (PubMed:17653269). {ECO:0000269|PubMed:17653269}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_025822212.1 | 2e-85 | NAC domain-containing protein 35-like | ||||
Swissprot | Q9ZVP8 | 2e-74 | NAC35_ARATH; NAC domain-containing protein 35 | ||||
TrEMBL | B9FYR4 | 3e-89 | B9FYR4_ORYSJ; Uncharacterized protein | ||||
STRING | LPERR08G01330.1 | 6e-88 | (Leersia perrieri) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP7706 | 36 | 50 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G02450.1 | 6e-77 | NAC domain containing protein 35 |
Publications ? help Back to Top | |||
---|---|---|---|
|