PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PGSC0003DMP400035081 | ||||||||
Common Name | LOC102581569 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 142aa MW: 16454.8 Da PI: 9.9554 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 105.5 | 2.7e-33 | 55 | 113 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYGqK vk++++prsYYrCt++gC+vkk+v+r ++d++vv++tYeg H+h+ PGSC0003DMP400035081 55 LDDGYRWRKYGQKAVKNNNYPRSYYRCTHEGCNVKKQVQRLSKDETVVVTTYEGMHTHP 113 59********************************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 3.7E-35 | 40 | 113 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 8.11E-30 | 47 | 114 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 30.113 | 50 | 115 | IPR003657 | WRKY domain |
SMART | SM00774 | 8.6E-39 | 55 | 114 | IPR003657 | WRKY domain |
Pfam | PF03106 | 3.4E-27 | 56 | 113 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 142 aa Download sequence Send to blast |
MENVVVGYYS MNGGLKTTSR DEMMGVVQNH NLSVKNKKIK KPRFAFQTKS QVDILDDGYR 60 WRKYGQKAVK NNNYPRSYYR CTHEGCNVKK QVQRLSKDET VVVTTYEGMH THPIDKPNDN 120 FEQILHQMHI LPNPPIPIPF N* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 2e-28 | 45 | 114 | 7 | 76 | Probable WRKY transcription factor 4 |
2lex_A | 2e-28 | 45 | 114 | 7 | 76 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | PGSC0003DMP400035081 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HG975514 | 2e-85 | HG975514.1 Solanum lycopersicum chromosome ch02, complete genome. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006338711.1 | 1e-103 | PREDICTED: probable WRKY transcription factor 45 | ||||
Swissprot | Q9FYA2 | 3e-48 | WRK75_ARATH; Probable WRKY transcription factor 75 | ||||
TrEMBL | M1BSQ7 | 1e-102 | M1BSQ7_SOLTU; Uncharacterized protein | ||||
STRING | PGSC0003DMT400052057 | 1e-103 | (Solanum tuberosum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA2204 | 24 | 61 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G13080.1 | 8e-50 | WRKY DNA-binding protein 75 |
Link Out ? help Back to Top | |
---|---|
Phytozome | PGSC0003DMP400035081 |
Entrez Gene | 102581569 |