PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PEQU_37723 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 132aa MW: 14767.7 Da PI: 8.0351 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 117.5 | 6.4e-37 | 11 | 74 | 34 | 97 |
NF-YB 34 tvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 qec+sefisf+tseasdkcqrekrktingddllwa+atlGfedy+eplk+yl+kyre+eg+ PEQU_37723 11 PCQECISEFISFITSEASDKCQREKRKTINGDDLLWAMATLGFEDYIEPLKLYLQKYREIEGDG 74 679**********************************************************996 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF47113 | 1.09E-25 | 12 | 83 | IPR009072 | Histone-fold |
Gene3D | G3DSA:1.10.20.10 | 7.3E-33 | 12 | 85 | IPR009072 | Histone-fold |
PRINTS | PR00615 | 6.4E-22 | 12 | 30 | No hit | No description |
Pfam | PF00808 | 1.7E-12 | 13 | 48 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 6.4E-22 | 31 | 49 | No hit | No description |
PRINTS | PR00615 | 6.4E-22 | 50 | 68 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 132 aa Download sequence Send to blast |
MARLLRTRRR PCQECISEFI SFITSEASDK CQREKRKTIN GDDLLWAMAT LGFEDYIEPL 60 KLYLQKYREI EGDGKGSAKG ADNSIKRDAG SLQGGNLPGT SMQGDVKMLQ QGSFTQGMSY 120 MNTQFHNGDL SS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1n1j_A | 5e-29 | 13 | 69 | 37 | 93 | NF-YB |
4awl_B | 5e-29 | 13 | 69 | 38 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
4csr_A | 5e-29 | 13 | 69 | 38 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020596650.1 | 2e-85 | LOW QUALITY PROTEIN: nuclear transcription factor Y subunit B-1-like | ||||
Swissprot | P25209 | 9e-56 | NFYB_MAIZE; Nuclear transcription factor Y subunit B | ||||
TrEMBL | A0A2H3XH40 | 5e-64 | A0A2H3XH40_PHODC; nuclear transcription factor Y subunit B-like isoform X2 | ||||
STRING | XP_008792219.1 | 2e-64 | (Phoenix dactylifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP201 | 38 | 331 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G53340.1 | 3e-48 | nuclear factor Y, subunit B10 |
Publications ? help Back to Top | |||
---|---|---|---|
|