PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PEQU_12448 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 108aa MW: 12303.1 Da PI: 7.7911 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 112.6 | 2.2e-35 | 1 | 78 | 17 | 94 |
NF-YB 17 mkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrele 94 mk+vlP++akisk+ak+t+qec+sefi+f+t+easdkc++e+r+t++g+d+++a+ lG+++y+ + k yl+kyre PEQU_12448 1 MKQVLPSKAKISKEAKQTMQECASEFIAFITGEASDKCRKENRQTLSGEDICHAMKLLGLDKYACSAKSYLQKYREHC 78 9**************************************************************************964 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 2.1E-32 | 1 | 91 | IPR009072 | Histone-fold |
Pfam | PF00808 | 1.1E-17 | 1 | 55 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
SuperFamily | SSF47113 | 8.38E-26 | 1 | 87 | IPR009072 | Histone-fold |
PRINTS | PR00615 | 1.3E-12 | 19 | 37 | No hit | No description |
PRINTS | PR00615 | 1.3E-12 | 38 | 56 | No hit | No description |
PRINTS | PR00615 | 1.3E-12 | 57 | 75 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 108 aa Download sequence Send to blast |
MKQVLPSKAK ISKEAKQTMQ ECASEFIAFI TGEASDKCRK ENRQTLSGED ICHAMKLLGL 60 DKYACSAKSY LQKYREHCEK SEAIKNTEPM ETDMTDMLQI YCKGNQHS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 7e-27 | 1 | 76 | 17 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 7e-27 | 1 | 76 | 17 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020580614.1 | 1e-75 | transcriptional activator hap3-like | ||||
Swissprot | O82248 | 8e-32 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
TrEMBL | A0A2I0XBB5 | 4e-45 | A0A2I0XBB5_9ASPA; Nuclear transcription factor Y subunit B-5 | ||||
STRING | Pavir.Eb03825.1.p | 9e-35 | (Panicum virgatum) | ||||
STRING | XP_008796244.1 | 9e-35 | (Phoenix dactylifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP2917 | 38 | 87 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G47810.1 | 3e-34 | nuclear factor Y, subunit B5 |
Publications ? help Back to Top | |||
---|---|---|---|
|