PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PDK_30s1067021g003 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Coryphoideae; Phoeniceae; Phoenix
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 171aa MW: 18804.1 Da PI: 8.8727 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 98.2 | 5.3e-31 | 89 | 147 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDg++WrKYG+K+vk+s++pr+YYrC+++gC vkk+ver+ edp++v++tYeg Hnh+ PDK_30s1067021g003 89 LDDGFKWRKYGKKSVKNSPNPRNYYRCSTEGCGVKKRVERDGEDPSYVITTYEGVHNHT 147 59********************************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 3.2E-33 | 77 | 149 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 2.09E-28 | 81 | 149 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 31.399 | 84 | 149 | IPR003657 | WRKY domain |
SMART | SM00774 | 8.0E-36 | 89 | 148 | IPR003657 | WRKY domain |
Pfam | PF03106 | 6.3E-25 | 90 | 146 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009867 | Biological Process | jasmonic acid mediated signaling pathway | ||||
GO:0042742 | Biological Process | defense response to bacterium | ||||
GO:0050832 | Biological Process | defense response to fungus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 171 aa Download sequence Send to blast |
MAYFHSQRSN DLAMAMSLAL GRHSGRPMAL NASDCTLFDE ASVAWQLEGR AVPLMARDSS 60 SRIYGSGMQT RKEGVFRVAF RTKSEIDILD DGFKWRKYGK KSVKNSPNPR NYYRCSTEGC 120 GVKKRVERDG EDPSYVITTY EGVHNHTSPG VMYLAPDGCD SGGGSLVAGG F |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 4e-28 | 80 | 149 | 8 | 77 | Probable WRKY transcription factor 4 |
2lex_A | 4e-28 | 80 | 149 | 8 | 77 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). Involved in defense responses. May act as positive regulator of salicylic acid (SA)-mediated signaling and negative regulator of jasmonic acid (JA)-mediated signaling (PubMed:21030507). {ECO:0000250, ECO:0000269|PubMed:21030507}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_008793280.1 | 1e-126 | probable WRKY transcription factor 51 | ||||
Swissprot | Q93WU9 | 8e-42 | WRK51_ARATH; Probable WRKY transcription factor 51 | ||||
TrEMBL | A0A2H3Y507 | 1e-124 | A0A2H3Y507_PHODC; probable WRKY transcription factor 51 | ||||
STRING | XP_008793279.1 | 1e-123 | (Phoenix dactylifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP441 | 37 | 206 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G64810.1 | 3e-44 | WRKY DNA-binding protein 51 |
Publications ? help Back to Top | |||
---|---|---|---|
|