PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Ote100103720001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
|
||||||||
Family | YABBY | ||||||||
Protein Properties | Length: 80aa MW: 9329.6 Da PI: 9.3915 | ||||||||
Description | YABBY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | YABBY | 92.7 | 8.9e-29 | 37 | 80 | 116 | 159 |
YABBY 116 irPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaakn 159 PekrqrvPsayn+fikeeiqrika+nP+ishreafs+aakn Ote100103720001|100103720001 37 FSAPEKRQRVPSAYNQFIKEEIQRIKANNPEISHREAFSTAAKN 80 568****************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF47095 | 3.8E-6 | 35 | 78 | IPR009071 | High mobility group box domain |
Pfam | PF04690 | 3.4E-27 | 36 | 80 | IPR006780 | YABBY protein |
Gene3D | G3DSA:1.10.30.10 | 8.4E-4 | 45 | 72 | IPR009071 | High mobility group box domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0007275 | Biological Process | multicellular organism development |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 80 aa Download sequence Send to blast |
MQQLARCCHN SMRPLQQPLD CEYGXXXXXX XXFPARFSAP EKRQRVPSAY NQFIKEEIQR 60 IKANNPEISH REAFSTAAKN |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Promotes adaxial cell identity. Regulates the initiation of embryonic shoot apical meristem (SAM) development. {ECO:0000269|PubMed:19837869}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_850080.1 | 4e-21 | plant-specific transcription factor YABBY family protein | ||||
Refseq | NP_850081.1 | 4e-21 | plant-specific transcription factor YABBY family protein | ||||
Swissprot | Q8GW46 | 3e-22 | YAB5_ARATH; Axial regulator YABBY 5 | ||||
TrEMBL | A0A2P5WNX6 | 1e-20 | A0A2P5WNX6_GOSBA; Uncharacterized protein | ||||
STRING | AT2G26580.1 | 1e-20 | (Arabidopsis thaliana) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA381 | 24 | 163 |
Publications ? help Back to Top | |||
---|---|---|---|
|