PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Ote100034290001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
|
||||||||
Family | HSF | ||||||||
Protein Properties | Length: 94aa MW: 10974.4 Da PI: 7.6811 | ||||||||
Description | HSF family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | HSF_DNA-bind | 86.9 | 2.7e-27 | 21 | 79 | 2 | 60 |
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHT CS HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmY 60 Fl+k+y++++d++++++isw+++g++f+v+++ efa+++LpkyFkh+nf+SFvRQLn+Y Ote100034290001|100034290001 21 FLTKTYQLVDDHSVDDVISWNADGTTFIVWNQAEFARDLLPKYFKHNNFSSFVRQLNTY 79 9********************************************************** PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.10 | 4.4E-28 | 15 | 80 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
SMART | SM00415 | 7.8E-27 | 17 | 88 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
SuperFamily | SSF46785 | 2.38E-24 | 18 | 80 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
PRINTS | PR00056 | 1.4E-16 | 21 | 44 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
Pfam | PF00447 | 6.2E-23 | 21 | 80 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
PRINTS | PR00056 | 1.4E-16 | 59 | 71 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
PRINTS | PR00056 | 1.4E-16 | 72 | 84 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 94 aa Download sequence Send to blast |
MERKGGESYG EDMPRLVPTP FLTKTYQLVD DHSVDDVISW NADGTTFIVW NQAEFARDLL 60 PKYFKHNNFS SFVRQLNTYV INPSISARLT LRFR |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5d5u_B | 3e-19 | 10 | 79 | 19 | 87 | Heat shock factor protein 1 |
5d5v_B | 3e-19 | 10 | 79 | 19 | 87 | Heat shock factor protein 1 |
5d5v_D | 3e-19 | 10 | 79 | 19 | 87 | Heat shock factor protein 1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional regulator that specifically binds DNA of heat shock promoter elements (HSE). {ECO:0000250}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011076201.1 | 1e-40 | heat stress transcription factor B-2a | ||||
Refseq | XP_011076202.1 | 1e-40 | heat stress transcription factor B-2a | ||||
Refseq | XP_028108220.1 | 5e-41 | heat stress transcription factor B-2a | ||||
Swissprot | Q6Z9C8 | 2e-35 | HFB2B_ORYSJ; Heat stress transcription factor B-2b | ||||
TrEMBL | A0A2Z4K5C0 | 4e-42 | A0A2Z4K5C0_TECGR; HSF2 protein | ||||
STRING | Migut.F00357.1.p | 7e-40 | (Erythranthe guttata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA572 | 24 | 113 |
Publications ? help Back to Top | |||
---|---|---|---|
|