PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Oropetium_20150105_16100A | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 122aa MW: 13467.5 Da PI: 5.216 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 142.2 | 1.3e-44 | 32 | 116 | 2 | 86 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkv 85 reqd+++Pian++rim++vlP +aki+++ake+vqecvsefisfvt+ea+d+c+ e+rkt++++d+lwa+ +lGf+dyv pl++ Oropetium_20150105_16100A 32 REQDQLMPIANMVRIMRRVLPPHAKIADNAKEVVQECVSEFISFVTGEANDRCRGEHRKTVTAEDVLWAMDHLGFDDYVGPLRA 115 89*********************************************************************************9 PP NF-YB 86 y 86 y Oropetium_20150105_16100A 116 Y 116 9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 4.6E-41 | 29 | 117 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 8.54E-32 | 34 | 119 | IPR009072 | Histone-fold |
Pfam | PF00808 | 6.0E-23 | 38 | 101 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 2.0E-11 | 65 | 83 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 68 | 84 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 2.0E-11 | 84 | 102 | No hit | No description |
PRINTS | PR00615 | 2.0E-11 | 103 | 121 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 122 aa Download sequence Send to blast |
MAKPRTPPTE AAAEEIELPP VPAVRAEPVV IREQDQLMPI ANMVRIMRRV LPPHAKIADN 60 AKEVVQECVS EFISFVTGEA NDRCRGEHRK TVTAEDVLWA MDHLGFDDYV GPLRAYAPAH 120 A* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5g49_A | 1e-45 | 29 | 116 | 4 | 91 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. Plays a role in the regulation of the embryogenesis. Involved in the abscisic acid (ABA) signaling pathway. {ECO:0000269|PubMed:12509518, ECO:0000269|PubMed:17322342}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Oropetium_20150105_16100A |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004966908.1 | 1e-51 | nuclear transcription factor Y subunit B-10 | ||||
Swissprot | Q84W66 | 1e-43 | NFYB6_ARATH; Nuclear transcription factor Y subunit B-6 | ||||
TrEMBL | K3Y2D4 | 4e-50 | K3Y2D4_SETIT; Uncharacterized protein | ||||
STRING | Si008357m | 6e-51 | (Setaria italica) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP201 | 38 | 331 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G47670.2 | 9e-46 | nuclear factor Y, subunit B6 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Oropetium_20150105_16100A |