![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | OB01G14200.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 119aa MW: 13628 Da PI: 10.1063 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 53.3 | 6.4e-17 | 17 | 64 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g W++eEde+l+ +++ G tW+++a+ g++R++k+c++rw +yl OB01G14200.1 17 KGLWSPEEDERLYTHITRCGVSTWSSVAQLAGLRRSGKSCRLRWMNYL 64 678*******************************************97 PP | |||||||
2 | Myb_DNA-binding | 45 | 2.5e-14 | 72 | 113 | 3 | 46 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 + T E e +v + k+lG++ W+ Ia++m+ gRt++++k++w++ OB01G14200.1 72 PITDREAETIVSLQKLLGNR-WSVIAAKMP-GRTDNEIKNYWNS 113 67999***************.*********.***********95 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 21.899 | 12 | 68 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 4.12E-28 | 16 | 111 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.6E-11 | 16 | 66 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.1E-14 | 17 | 64 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 3.6E-21 | 18 | 71 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 2.32E-8 | 20 | 64 | No hit | No description |
PROSITE profile | PS51294 | 15.697 | 69 | 119 | IPR017930 | Myb domain |
SMART | SM00717 | 3.1E-12 | 69 | 117 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.6E-11 | 72 | 113 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.2E-22 | 72 | 117 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 5.54E-8 | 72 | 112 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 119 aa Download sequence Send to blast |
EAESGEAAAA AAEKERKGLW SPEEDERLYT HITRCGVSTW SSVAQLAGLR RSGKSCRLRW 60 MNYLRPDLKK EPITDREAET IVSLQKLLGN RWSVIAAKMP GRTDNEIKNY WNSRIRKXX |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 8e-27 | 17 | 117 | 27 | 126 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Possible transcription activator in response to an external signal. May be involved in the regulation of flavonoid biosynthesis. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | OB01G14200.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015694952.1 | 5e-80 | PREDICTED: myb-related protein Hv33-like | ||||
Swissprot | P20027 | 3e-47 | MYB3_HORVU; Myb-related protein Hv33 | ||||
TrEMBL | J3KWR4 | 2e-79 | J3KWR4_ORYBR; Uncharacterized protein | ||||
STRING | OB01G14200.1 | 3e-80 | (Oryza brachyantha) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP8703 | 25 | 45 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G09540.1 | 8e-46 | myb domain protein 61 |