PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Niben101Scf03362g01014.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
Family | HB-other | ||||||||
Protein Properties | Length: 97aa MW: 11446.1 Da PI: 10.2815 | ||||||||
Description | HB-other family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 29.9 | 9.2e-10 | 41 | 74 | 22 | 55 |
SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS Homeobox 22 nrypsaeereeLAkklgLterqVkvWFqNrRake 55 +yp++ ++ LA+++gL+ +q+ +WF N+R ++ Niben101Scf03362g01014.1 41 WPYPTEGDKNSLAESTGLDPKQINNWFINQRKRH 74 58*****************************985 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50071 | 12.698 | 14 | 77 | IPR001356 | Homeobox domain |
SuperFamily | SSF46689 | 7.27E-21 | 15 | 88 | IPR009057 | Homeodomain-like |
SMART | SM00389 | 3.9E-13 | 16 | 81 | IPR001356 | Homeobox domain |
Gene3D | G3DSA:1.10.10.60 | 3.1E-29 | 19 | 79 | IPR009057 | Homeodomain-like |
CDD | cd00086 | 1.63E-11 | 26 | 78 | No hit | No description |
Pfam | PF05920 | 2.1E-18 | 34 | 73 | IPR008422 | Homeobox KN domain |
PROSITE pattern | PS00027 | 0 | 52 | 75 | IPR017970 | Homeobox, conserved site |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 97 aa Download sequence Send to blast |
MLPLLANSSL KLEFSKKKKK GKLPKEARQL LLAWWNDHYR WPYPTEGDKN SLAESTGLDP 60 KQINNWFINQ RKRHWKPSEN MQLAVMDNLS GQFFSDD |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Plays a role in meristem function. Contributes to the shoot apical meristem (SAM) maintenance and organ separation by controlling boundary establishment in embryo in a CUC1, CUC2 and STM-dependent manner. Involved in maintaining cells in an undifferentiated, meristematic state. Probably binds to the DNA sequence 5'-TGAC-3'. {ECO:0000269|PubMed:16798887}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Seems to be repressed by AS2 and AS1 but induced by STM, CUC1 and CUC2. {ECO:0000269|PubMed:11311158, ECO:0000269|PubMed:16798887}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009759718.1 | 3e-60 | PREDICTED: homeobox protein knotted-1-like 6 | ||||
Refseq | XP_016490194.1 | 5e-61 | PREDICTED: homeobox protein knotted-1-like 6 | ||||
Swissprot | Q84JS6 | 2e-41 | KNAT6_ARATH; Homeobox protein knotted-1-like 6 | ||||
TrEMBL | A0A1S4BMV4 | 1e-59 | A0A1S4BMV4_TOBAC; homeobox protein knotted-1-like 6 | ||||
TrEMBL | A0A1U7UZY6 | 7e-59 | A0A1U7UZY6_NICSY; homeobox protein knotted-1-like 6 | ||||
STRING | XP_009759718.1 | 1e-59 | (Nicotiana sylvestris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA753 | 24 | 80 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G23380.1 | 4e-37 | KNOTTED1-like homeobox gene 6 |
Publications ? help Back to Top | |||
---|---|---|---|
|