![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Niben101Scf01903g02003.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 122aa MW: 13558.4 Da PI: 10.7497 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 57.9 | 2.3e-18 | 9 | 54 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +g+W++eEd l ++v ++G+++W++I+ ++ gR++k+c++rw + Niben101Scf01903g02003.1 9 KGSWSPEEDAMLTKLVDEHGPRNWSLISTGIP-GRSGKSCRLRWCNQ 54 799*****************************.***********985 PP | |||||||
2 | Myb_DNA-binding | 56.9 | 4.8e-18 | 63 | 105 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 ++T+ Ed ++++a++ +G++ W+tIar ++ gRt++ +k++w++ Niben101Scf01903g02003.1 63 PFTPSEDAIILQAHAVHGNR-WATIARLLP-GRTDNAIKNHWNST 105 89******************.*********.***********986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 19.47 | 4 | 55 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 2.06E-31 | 7 | 102 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.1E-15 | 8 | 57 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 4.1E-18 | 9 | 54 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.3E-25 | 10 | 62 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.97E-14 | 11 | 53 | No hit | No description |
PROSITE profile | PS51294 | 25.462 | 56 | 110 | IPR017930 | Myb domain |
SMART | SM00717 | 2.4E-15 | 60 | 108 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.5E-15 | 63 | 105 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 5.6E-24 | 63 | 109 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.21E-12 | 63 | 106 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 122 aa Download sequence Send to blast |
MDGTGEKIKG SWSPEEDAML TKLVDEHGPR NWSLISTGIP GRSGKSCRLR WCNQLSPAVQ 60 HRPFTPSEDA IILQAHAVHG NRWATIARLL PGRTDNAIKN HWNSTLRRKR HAPEAAAAAT 120 MF |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1gv2_A | 8e-41 | 6 | 109 | 1 | 104 | MYB PROTO-ONCOGENE PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that functions in salt stress response. Acts as negative regulator of NHX7/SOS1 and CBL4/SOS3 induction in response to salt stress (PubMed:23809151). In response to auxin, activates the transcription of the auxin-responsive gene IAA19. The IAA19 transcription activation by MYB73 is enhanced by direct interaction between MYB73 and PYL8 (PubMed:24894996). {ECO:0000269|PubMed:23809151, ECO:0000269|PubMed:24894996}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by salt stress. {ECO:0000269|PubMed:23809151}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009785340.1 | 1e-84 | PREDICTED: myb protein-like | ||||
Refseq | XP_016515570.1 | 8e-85 | PREDICTED: transcription factor MYB44-like | ||||
Swissprot | O23160 | 1e-53 | MYB73_ARATH; Transcription factor MYB73 | ||||
TrEMBL | A0A1S4DQ72 | 2e-83 | A0A1S4DQ72_TOBAC; transcription factor MYB44-like | ||||
TrEMBL | A0A1U7XFV8 | 2e-83 | A0A1U7XFV8_NICSY; myb protein-like | ||||
STRING | XP_009785340.1 | 4e-84 | (Nicotiana sylvestris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA12883 | 16 | 20 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G37260.1 | 2e-55 | myb domain protein 73 |
Publications ? help Back to Top | |||
---|---|---|---|
|