PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Niben101Scf01591g00001.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 169aa MW: 19485.2 Da PI: 9.8418 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 77 | 4.3e-24 | 5 | 68 | 65 | 128 |
NAM 65 dkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 ++k ++g+r+nra+ +gyWkatg dke++++k+ +glkk+Lv+y g+ pkgekt+W+mheyrl Niben101Scf01591g00001.1 5 NTKRSNGNRPNRAAGDGYWKATGADKEIKDNKNVIIGLKKSLVYYIGKPPKGEKTNWIMHEYRL 68 467889************************9999****************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51005 | 31.75 | 1 | 95 | IPR003441 | NAC domain |
SuperFamily | SSF101941 | 1.7E-29 | 4 | 95 | IPR003441 | NAC domain |
Pfam | PF02365 | 2.6E-11 | 11 | 68 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 169 aa Download sequence Send to blast |
MVCLNTKRSN GNRPNRAAGD GYWKATGADK EIKDNKNVII GLKKSLVYYI GKPPKGEKTN 60 WIMHEYRLPD IPNLAERDIN NWKLDEWVLC RIYKKSDRDN TMVTQRKRIR DAYETKAGRG 120 NSNDSDQDFN NDVQIVLVSW KSSPKLIKIN SAKLDDALEA KLFLENLID |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 4e-29 | 7 | 95 | 82 | 165 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 4e-29 | 7 | 95 | 82 | 165 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 4e-29 | 7 | 95 | 82 | 165 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 4e-29 | 7 | 95 | 82 | 165 | NO APICAL MERISTEM PROTEIN |
3swm_A | 4e-29 | 7 | 95 | 85 | 168 | NAC domain-containing protein 19 |
3swm_B | 4e-29 | 7 | 95 | 85 | 168 | NAC domain-containing protein 19 |
3swm_C | 4e-29 | 7 | 95 | 85 | 168 | NAC domain-containing protein 19 |
3swm_D | 4e-29 | 7 | 95 | 85 | 168 | NAC domain-containing protein 19 |
3swp_A | 4e-29 | 7 | 95 | 85 | 168 | NAC domain-containing protein 19 |
3swp_B | 4e-29 | 7 | 95 | 85 | 168 | NAC domain-containing protein 19 |
3swp_C | 4e-29 | 7 | 95 | 85 | 168 | NAC domain-containing protein 19 |
3swp_D | 4e-29 | 7 | 95 | 85 | 168 | NAC domain-containing protein 19 |
4dul_A | 4e-29 | 7 | 95 | 82 | 165 | NAC domain-containing protein 19 |
4dul_B | 4e-29 | 7 | 95 | 82 | 165 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator that positively regulates age-dependent senescence, dark-induced leaf senescence and stress-induced senescence. Regulates leaf senescence through the modulation of the expression of senescence-associated genes SGR1/NYE1, SAG113 and SAUR36/SAG201, which are involved in chlorophyll degradation, and abscisic acid (ABA) and auxin promotion of senescence, respectively. Promotes reactive oxygen species (ROS) production during age-dependent and stress-induced senescence. Regulates positively auxin-mediated responses in roots (PubMed:27388337). Stress-responsive NAC transcription factor involved in ABA-inducible leaf senescence signaling (PubMed:26518251). Required for normal seed development and morphology (PubMed:18849494). {ECO:0000269|PubMed:18849494, ECO:0000269|PubMed:26518251, ECO:0000269|PubMed:27388337}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By abscisic acid (ABA) (PubMed:26518251). Induced by salinity and osmotic stress, and during leaf senescence (PubMed:27388337). {ECO:0000269|PubMed:26518251, ECO:0000269|PubMed:27388337}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009793862.1 | 3e-80 | PREDICTED: NAC domain-containing protein 102-like | ||||
Refseq | XP_016458645.1 | 3e-80 | PREDICTED: NAC domain-containing protein 102-like | ||||
Swissprot | Q9CAR0 | 7e-32 | NAC32_ARATH; NAC transcription factor 32 | ||||
TrEMBL | A0A1S3Z2J1 | 7e-79 | A0A1S3Z2J1_TOBAC; NAC domain-containing protein 102-like | ||||
TrEMBL | A0A1U7XP91 | 8e-79 | A0A1U7XP91_NICSY; NAC domain-containing protein 102-like | ||||
STRING | XP_009626689.1 | 5e-80 | (Nicotiana tomentosiformis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA13936 | 12 | 13 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G77450.1 | 5e-34 | NAC domain containing protein 32 |