PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Niben101Scf01521g16002.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
Family | HD-ZIP | ||||||||
Protein Properties | Length: 127aa MW: 14851.7 Da PI: 7.7334 | ||||||||
Description | HD-ZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 44.6 | 2.4e-14 | 55 | 87 | 24 | 56 |
S--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS Homeobox 24 ypsaeereeLAkklgLterqVkvWFqNrRakek 56 ++ +e++ +LA+ lgL+ rq+ +WFqNrRak+k Niben101Scf01521g16002.1 55 KVEEERKMQLARALGLQPRQIAIWFQNRRAKWK 87 678999**************************9 PP | |||||||
2 | HD-ZIP_I/II | 98.6 | 6e-32 | 48 | 123 | 16 | 91 |
HD-ZIP_I/II 16 esFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 + + +k+e erK++lar+Lglqprq+a+WFqnrRA++ktkqlEkdy++Lkr+++a+k+en++L +++++L++e+ Niben101Scf01521g16002.1 48 DLSNDGNKVEEERKMQLARALGLQPRQIAIWFQNRRAKWKTKQLEKDYDVLKRQFEAVKAENDSLLAHNQKLHAEV 123 4445678*****************************************************************9886 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00389 | 2.0E-9 | 25 | 93 | IPR001356 | Homeobox domain |
Gene3D | G3DSA:1.10.10.60 | 5.8E-15 | 54 | 97 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 1.67E-13 | 54 | 98 | IPR009057 | Homeodomain-like |
Pfam | PF00046 | 9.8E-12 | 55 | 87 | IPR001356 | Homeobox domain |
CDD | cd00086 | 5.36E-10 | 58 | 90 | No hit | No description |
PROSITE profile | PS50071 | 12.843 | 58 | 89 | IPR001356 | Homeobox domain |
PRINTS | PR00031 | 2.2E-6 | 60 | 69 | IPR000047 | Helix-turn-helix motif |
PROSITE pattern | PS00027 | 0 | 64 | 87 | IPR017970 | Homeobox, conserved site |
PRINTS | PR00031 | 2.2E-6 | 69 | 85 | IPR000047 | Helix-turn-helix motif |
Pfam | PF02183 | 2.9E-15 | 89 | 123 | IPR003106 | Leucine zipper, homeobox-associated |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 127 aa Download sequence Send to blast |
MPFFPPNVML HTPHQDFQGS GSFLGKRTMS FSGMEANNNC EKNHEEEDLS NDGNKVEEER 60 KMQLARALGL QPRQIAIWFQ NRRAKWKTKQ LEKDYDVLKR QFEAVKAEND SLLAHNQKLH 120 AEVWPNQ |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that may act in the sucrose-signaling pathway. {ECO:0000269|PubMed:11292072}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_019246111.1 | 1e-68 | PREDICTED: homeobox-leucine zipper protein ATHB-13-like | ||||
Swissprot | Q8LC03 | 3e-40 | ATB13_ARATH; Homeobox-leucine zipper protein ATHB-13 | ||||
TrEMBL | A0A1J6IHB8 | 2e-67 | A0A1J6IHB8_NICAT; Homeobox-leucine zipper protein athb-13 | ||||
STRING | XP_009794845.1 | 9e-58 | (Nicotiana sylvestris) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G69780.1 | 1e-42 | HD-ZIP family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|