PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Migut.O00508.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 133aa MW: 14860.6 Da PI: 5.0038 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 145 | 1.7e-45 | 4 | 98 | 3 | 97 |
NF-YB 3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 e++++lPianv+r+mkk+lP ak+s++ake +q+c+sefi fvt+easd+c++e+rkt+ngdd++wal++lGf++y e++ yl+++r +e+e+ Migut.O00508.1.p 4 EHEKMLPIANVGRMMKKILPPSAKVSREAKERMQQCASEFICFVTGEASDRCHKENRKTVNGDDICWALSSLGFDNYSEAMLRYLQNFRGFEREN 98 7899****************************************************************************************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 9.2E-43 | 3 | 115 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 2.84E-34 | 7 | 112 | IPR009072 | Histone-fold |
Pfam | PF00808 | 6.2E-24 | 9 | 72 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 2.2E-15 | 36 | 54 | No hit | No description |
PRINTS | PR00615 | 2.2E-15 | 55 | 73 | No hit | No description |
PRINTS | PR00615 | 2.2E-15 | 74 | 92 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 133 aa Download sequence Send to blast |
MSDEHEKMLP IANVGRMMKK ILPPSAKVSR EAKERMQQCA SEFICFVTGE ASDRCHKENR 60 KTVNGDDICW ALSSLGFDNY SEAMLRYLQN FRGFERENAN QSNNCKANSG EVEKDEGSIC 120 GDISAPSFDF GY* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 7e-35 | 4 | 92 | 3 | 91 | Transcription factor HapC (Eurofung) |
4g92_B | 7e-35 | 4 | 92 | 3 | 91 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Migut.O00508.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012847412.1 | 8e-96 | PREDICTED: nuclear transcription factor Y subunit B-5-like | ||||
Refseq | XP_012857060.1 | 9e-96 | PREDICTED: nuclear transcription factor Y subunit B-4-like | ||||
Swissprot | O82248 | 3e-45 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
TrEMBL | A0A022QM27 | 5e-76 | A0A022QM27_ERYGU; Uncharacterized protein (Fragment) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA111 | 24 | 356 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G47810.1 | 1e-47 | nuclear factor Y, subunit B5 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Migut.O00508.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|