PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Migut.L00133.1.p

Organism

Mimulus guttatus

Taxonomic ID

4155

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe

Family

CAMTA

Protein Properties

Length: 123aa MW: 14687.7 Da PI: 9.6427

Description

CAMTA family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Migut.L00133.1.p	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	CG-1	169.2	6.4e-53	20	122	2	104
CG-1 2 lkekkrwlkneeiaaiLenfekheltlelktrpksgsliLynrkkvryfrkDGyswkkkkdgktvrEdhekLKvggvevlycyYahseenptf 94 l+ ++rwl++ ei++iL+n++k++++ e+++rp++gsl+L++rk++ryfrkDG++w+kkkdgktv+E+he+LK g+++vl+cyYah+e+n++f Migut.L00133.1.p 20 LEAQHRWLRPAEICEILQNYKKFRIAPEPPSRPPNGSLFLFDRKVLRYFRKDGHNWRKKKDGKTVKEAHERLKAGSIDVLHCYYAHGEDNENF 112 5669*************************************************************************************** PP CG-1 95 qrrcywlLee 104 qrr+yw+Lee Migut.L00133.1.p 113 QRRSYWMLEE 122 ******85 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51437	74.5	15	122	IPR005559	CG-1 DNA-binding domain
SMART	SM01076	9.6E-62	18	122	IPR005559	CG-1 DNA-binding domain
Pfam	PF03859	1.0E-45	21	121	IPR005559	CG-1 DNA-binding domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 123 aa Download sequence Send to blast
MADSRRYALN AQLDIEQILL EAQHRWLRPA EICEILQNYK KFRIAPEPPS RPPNGSLFLF 60 DRKVLRYFRK DGHNWRKKKD GKTVKEAHER LKAGSIDVLH CYYAHGEDNE NFQRRSYWML 120 EE*

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator that binds to the DNA consensus sequence 5'-[ACG]CGCG[GTC]-3' (By similarity). Regulates transcriptional activity in response to calcium signals (Probable). Binds calmodulin in a calcium-dependent manner (By similarity). Involved in freezing tolerance in association with CAMTA1 and CAMTA3. Contributes together with CAMTA1 and CAMTA3 to the positive regulation of the cold-induced expression of DREB1A/CBF3, DREB1B/CBF1 and DREB1C/CBF2 (PubMed:23581962). Involved together with CAMTA3 and CAMTA4 in the positive regulation of a general stress response (PubMed:25039701). Involved in tolerance to aluminum. Binds to the promoter of ALMT1 transporter and contributes to the positive regulation of aluminum-induced expression of ALMT1 (PubMed:25627216). {ECO:0000250\|UniProtKB:Q8GSA7, ECO:0000269\|PubMed:23581962, ECO:0000269\|PubMed:25039701, ECO:0000269\|PubMed:25627216, ECO:0000305\|PubMed:11925432}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Migut.L00133.1.p

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By salt, wounding, abscisic acid, H(2)O(2) and salicylic acid (PubMed:12218065). Induced by aluminum (PubMed:25627216). {ECO:0000269\|PubMed:12218065, ECO:0000269\|PubMed:25627216}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_012853297.1	2e-81	PREDICTED: calmodulin-binding transcription activator 3
Swissprot	Q6NPP4	6e-67	CMTA2_ARATH; Calmodulin-binding transcription activator 2
TrEMBL	A0A4D8Z707	3e-79	A0A4D8Z707_SALSN; Uncharacterized protein
STRING	Migut.L00133.1.p	3e-87	(Erythranthe guttata)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA14489	8	11

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G64220.2	3e-69	Calmodulin-binding transcription activator protein with CG-1 and Ankyrin domains

Link Out ? help Back to Top
Phytozome	Migut.L00133.1.p

Publications ? help Back to Top
Benn G, et al. A key general stress response motif is regulated non-uniformly by CAMTA transcription factors. Plant J., 2014. 80(1): p. 82-92 [PMID:25039701] Kidokoro S, et al. Different Cold-Signaling Pathways Function in the Responses to Rapid and Gradual Decreases in Temperature. Plant Cell, 2017. 29(4): p. 760-774 [PMID:28351986]