PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe

Family

MYB

Protein Properties

Length: 150aa MW: 17188.6 Da PI: 8.9373

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Migut.F01545.1.p	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	45.7	1.5e-14	39	83	2	47
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 g+W Ede+l av+++G ++W++I++ + R++kqck rw++ Migut.F01545.1.p 39 GAWKNTEDEILTAAVNKYGENQWSKISSLLV-PRSPKQCKARWYDC 83 79***************************.9********975 PP
2	Myb_DNA-binding	33.2	1.2e-10	92	133	3	47
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 WT+eEde+l+++ k++++ W+tIa + R + qc +r+ k+ Migut.F01545.1.p 92 EWTQEEDEKLLCLAKLMPKQ-WRTIAPIVE--RPPSQCLERYKKL 133 7***************99.****9..********997 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	23.046	33	88	IPR017930	Myb domain
SuperFamily	SSF46689	3.67E-20	36	118	IPR009057	Homeodomain-like
SMART	SM00717	5.0E-13	37	86	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	2.1E-21	39	91	IPR009057	Homeodomain-like
CDD	cd00167	2.81E-12	40	81	No hit	No description
Pfam	PF13921	8.6E-16	41	101	No hit	No description
CDD	cd11659	3.07E-25	86	135	No hit	No description
SMART	SM00717	1.6E-11	89	136	IPR001005	SANT/Myb domain
PROSITE profile	PS51294	12.914	89	138	IPR017930	Myb domain
Gene3D	G3DSA:1.10.10.60	8.5E-13	92	136	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 150 aa Download sequence Send to blast
MENTFTPRTP PESRSAIEAF RKGKLRNPRK KERSNIMGGA WKNTEDEILT AAVNKYGENQ 60 WSKISSLLVP RSPKQCKARW YDCLDPSINT TEWTQEEDEK LLCLAKLMPK QWRTIAPIVE 120 RPPSQCLERY KKLVDPTGAT DENPVLLQD*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
3jb9_W	5e-47	36	147	4	115	Pre-mRNA-splicing factor cdc5
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Component of the MAC complex that probably regulates defense responses through transcriptional control and thereby is essential for plant innate immunity. Possesses a sequence specific DNA sequence 'CTCAGCG' binding activity. Involved in mRNA splicing and cell cycle control. May also play a role in the response to DNA damage. {ECO:0000250\|UniProtKB:Q99459, ECO:0000269\|PubMed:17298883, ECO:0000269\|PubMed:17575050, ECO:0000269\|PubMed:8917598}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Migut.F01545.1.p

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_012842448.1	6e-79	PREDICTED: cell division cycle 5-like protein isoform X1
Swissprot	P92948	2e-49	CDC5L_ARATH; Cell division cycle 5-like protein
TrEMBL	A0A022QZR3	1e-105	A0A022QZR3_ERYGU; Uncharacterized protein

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA17957	3	4

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G09770.1	1e-51	cell division cycle 5

Link Out ? help Back to Top
Phytozome	Migut.F01545.1.p

Publications ? help Back to Top
Heyndrickx KS,Vandepoele K Systematic identification of functional plant modules through the integration of complementary data sources. Plant Physiol., 2012. 159(3): p. 884-901 [PMID:22589469] Li S, et al. MAC3A and MAC3B, Two Core Subunits of the MOS4-Associated Complex, Positively Influence miRNA Biogenesis. Plant Cell, 2018. 30(2): p. 481-494 [PMID:29437988]